KEGG   Bacteroides vulgatus: BVU_1935Help
Entry
BVU_1935          CDS       T00546                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bvu  Bacteroides vulgatus
Pathway
bvu00010  Glycolysis / Gluconeogenesis
bvu00030  Pentose phosphate pathway
bvu00051  Fructose and mannose metabolism
bvu00052  Galactose metabolism
bvu00680  Methane metabolism
bvu01100  Metabolic pathways
bvu01110  Biosynthesis of secondary metabolites
bvu01120  Microbial metabolism in diverse environments
bvu01130  Biosynthesis of antibiotics
bvu01200  Carbon metabolism
bvu01230  Biosynthesis of amino acids
bvu03018  RNA degradation
Module
bvu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bvu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BVU_1935
   00030 Pentose phosphate pathway
    BVU_1935
   00051 Fructose and mannose metabolism
    BVU_1935
   00052 Galactose metabolism
    BVU_1935
  Energy metabolism
   00680 Methane metabolism
    BVU_1935
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    BVU_1935
Enzymes [BR:bvu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BVU_1935
Protein phosphatases and associated proteins [BR:bvu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BVU_1935
Messenger RNA biogenesis [BR:bvu03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     BVU_1935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ABR39608
UniProt: A6L1P4
Position
complement(2517126..2518106)
Genome map
AA seq 326 aa AA seqDB search
MGTIKSIGILTSGGDAPGMNAAIRAVTRSAIYNGLKVYGIYRGYKGLVTDEIQEFKSQNV
SNIIQMGGTILKTARCKEFTTPEGRAQAYENMKKHEIDALVIIGGDGSLTGARIFAQEFD
VPCIGLPGTIDNDLYGTDTTIGYDTALNTILDAVDKIRDTATSHERLFFVEVMGRDAGFL
ALNGAIAAGAEAAIIPEFSTEVDQLEEFIEHGFRKSKSSSIVLVAESELTGGAMHYAERV
KNEYPQYDVRVTILGHLQRGGRPTAHDRIIASRMGVASIQALLEGQRNVMIGIDDDKIVY
VPFAKAIKNDKPIDRELVNVLHELSI
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgggaacgattaaaagtattggtattttaacctctggaggagatgctccgggaatgaat
gctgccattcgtgcagtcacacgttctgccatctataacggcttgaaagtatatggcatt
tatagaggttacaaaggattggtaacagatgaaattcaggaattcaaaagccaaaatgtt
agcaacatcatacaaatgggaggtaccattctgaaaaccgcccgttgcaaagaattcacg
acacccgaaggacgggcacaagcttacgaaaatatgaaaaagcacgagattgatgctttg
gtcattatcggcggtgacggttcgttgaccggtgcacgtatctttgctcaggaatttgat
gtgccttgtatcggtctgcccggaacgattgacaacgacctgtatggaaccgacaccacc
atcggctatgatacagctttgaacacaattttggatgcagtagataaaatccgtgatacg
gcaacttctcacgaacgcttattttttgttgaagtgatgggacgtgatgcaggtttcctg
gcattgaacggcgctattgccgcaggtgcagaagcagctattattccggaattcagcaca
gaagttgaccaattggaagaattcatcgaacatggtttccgcaaatccaagagcagtagc
atcgtattagtagccgaaagcgaactgaccgggggtgcaatgcactatgccgaacgtgtg
aagaacgaatatccgcaatacgatgtgcgtgtaacgatattaggacatttacaacgtggc
ggacgccccacagcgcatgaccgaatcattgccagccgtatgggagtggccagcatccaa
gcactattggaaggacaacgtaatgtaatgattggtattgatgatgataagattgtttat
gtacctttcgctaaagctataaagaacgacaagcctatagacagagaattggtgaatgta
cttcacgaactttctatctaa

DBGET integrated database retrieval system