KEGG   Bacteroides vulgatus: BVU_1964Help
Entry
BVU_1964          CDS       T00546                                 

Definition
3-oxo-5-alpha-steroid 4-dehydrogenase
Orthology
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
bvu  Bacteroides vulgatus
Brite
Enzymes [BR:bvu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     BVU_1964
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2545071..2545835
Genome map
AA seq 254 aa AA seqDB search
MGQQTFEFLLLAMSALAVIVFVALYYVRAGYGMFHTPKWGLSVNNKLGWVLMEAPVFLVM
LYLWWNSSVRFDAAPFLFFLLFELHYFQRSFIFPFLMKGKSRMPLAIMLMGVVFNVLNGL
MQGEWLFYLAPEGLYTDAWLSTPSFWLGVILFFIGMGINLHSDSVIRHLRKPGDTRHYLP
QKGMYRYVTSGNYFGELVEWIGFAVLTCSPAAWVFVLWTFANLAPRANSIRNRYREEFGK
DAVGKKKRMIPFIY
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgggacaacagacttttgaatttttgctattggcaatgtccgcacttgcggtgattgta
tttgtagccctctattatgtacgtgccggttatggtatgttccacaccccgaaatgggga
ctttcagtgaacaataaattaggttgggtactgatggaagcgcctgtattccttgtaatg
ctttatctgtggtggaacagcagcgtgcgttttgatgccgctcctttcctcttttttctt
ctttttgaattacattatttccagcgctcttttatcttccctttcctgatgaaaggaaag
agccggatgccccttgccattatgttgatgggagtggtctttaatgtcctgaacggactg
atgcagggcgaatggttgttctatctggctccggaaggactctatacagatgcctggctc
agtactccttctttttggcttggggttattctgttctttatagggatgggcattaatcta
cattccgacagtgtgatccgccatttacgtaaaccgggcgatacacgccattatttgccg
cagaagggaatgtaccgatatgtcacttcgggcaactattttggcgagttggtggaatgg
atagggtttgccgtactcacttgttcgcccgctgcatgggtgtttgtgctgtggacgttt
gctaatctggctccacgtgccaattccatccgtaaccgttatcgggaagagtttggtaag
gatgcggtaggaaaaaagaaaagaatgattccttttatttattga

DBGET integrated database retrieval system