KEGG   Bacteroides vulgatus: BVU_1971Help
Entry
BVU_1971          CDS       T00546                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bvu  Bacteroides vulgatus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bvu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BVU_1971
   01230 Biosynthesis of amino acids
    BVU_1971
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BVU_1971
   00030 Pentose phosphate pathway
    BVU_1971
   00051 Fructose and mannose metabolism
    BVU_1971
   00052 Galactose metabolism
    BVU_1971
  Energy metabolism
   00680 Methane metabolism
    BVU_1971
Enzymes [BR:bvu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BVU_1971
Protein phosphatases and associated proteins [BR:bvu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BVU_1971
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2551639..2552619
Genome map
AA seq 326 aa AA seqDB search
MKTIKCIGVLTSGGDASGMNAAIRAVTRSAICNGFKVKGIYRGYEGLINGEVKELTTQDV
SSVIQRGGTMLKTARSAEFQTVEGRKKAYDTMQREGIDALVIIGGNGSITGARIFAEEYD
VPCIGLPGTIDNDLYGTDFTIGYDTALNTIVECVDKIRDTATSHDRIFFVEVMGRDAGFL
AQNSAIASGAEAAIIPEDRTDVDQLEKFIGRGFRKTKNSSIVIVSESPKDGGAMHYAERV
KKEYPQYDVRVTILGHLQRGGSPSAYDRILASRLGAGAIDAILEGQRNVMIGIHNDEVVY
VPFSEAIKKDKPLDKSLIKVLDELSI
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaattaaatgtattggagtgctgacatccggaggggatgcttctggcatgaat
gccgctatccgtgcggtaacccggagtgcaatttgtaacggatttaaagtgaagggtatt
tatagaggatatgaagggctgattaatggagaagtgaaggaactgaccacccaggatgtg
agcagtgttattcaacgtggaggaacgatgttgaagacagcccgttctgctgaattccaa
acagtagaaggacgcaagaaagcatacgatactatgcagcgagaaggaattgatgctttg
gtgattataggtggaaatggttctattacaggagcccggatttttgcggaagaatatgat
gtgccttgtatcgggttacctggtacaatagataatgatctttatggtactgactttacc
ataggttacgatacggctttaaatacgattgtggaatgtgtggataaaatccgtgatacg
gcaacctctcacgaccgtatattctttgtggaagtgatgggacgtgatgccggttttctg
gctcaaaacagtgccattgcttctggtgctgaggcagcgattattcctgaagatcgtacg
gatgtggatcaattggagaaatttatcgggcgcggttttcgtaagacaaagaatagcagt
attgttattgtttccgagagtccgaaagacggaggtgccatgcattatgcagagcgtgtc
aagaaagaatatcctcaatatgatgtgcgtgttaccattttagggcatttgcaacgtgga
ggttcgcctagtgcttatgaccgtattcttgccagccgtctgggggcgggagctattgat
gccatattggaagggcagcgcaacgtgatgattggcattcataacgatgaggtggtatat
gtacctttttctgaggcaattaaaaaagacaagccccttgataaatcgcttatcaaggtg
cttgatgaattatctatttaa

DBGET integrated database retrieval system