KEGG   Bacteroides vulgatus: BVU_2052Help
Entry
BVU_2052          CDS       T00546                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bvu  Bacteroides vulgatus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bvu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BVU_2052
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BVU_2052
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BVU_2052
Enzymes [BR:bvu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BVU_2052
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2659673..2660974
Genome map
AA seq 433 aa AA seqDB search
MKYYSTNHQASDASLEEAVVKGLASDKGLYMPEAIKPLPQEFYDQIENLSFQEIAYRVAD
AFFGEDVPAETLKQIVYDTLSFDVPAVKVKDNIYSLELFHGPTLAFKDVGGRFMARLLGY
FIKKEGQKQVNVLVATSGDTGSAVANGFLGVEGIHVYVLYPKGKVSEIQEKQFTTLGRNI
TALEVDGTFDDCQALVKNAFMDADLNAHMKLTSANSINVARFLPQAFYYFYAYAQLKKEG
KADHLVVCVPSGNFGNITAGLFGKRMGLPVKRFIAANNRNDIFYQYLQTGKYNPRPSIAT
IANAMDVGDPSNFARVLALYGNSHAAITADISGATYADEQIRETVGEVYRETGYLLDPHG
ACGYRALSEGLSPSETGIFLETAHPAKFLETVEGIIGDKVEIPAKLQAFMKGTKQSVPME
KDFESFKGYLMKE
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaaatattacagtacgaatcaccaggcttccgatgcttctctggaagaagctgtagtg
aaggggctggcttctgacaaaggtttgtatatgcccgaggccatcaagccattgccgcaa
gagttttatgatcagattgagaatctgtcgtttcaggaaattgcttatcgcgtggccgat
gctttcttcggtgaggatgttcctgctgaaacactgaagcagatcgtttatgatacattg
agttttgatgttcctgccgtaaaggtaaaggataatatttactctttggaactgtttcat
ggtcctacattggcatttaaagatgtaggtggacgtttcatggcccgtttgttgggctac
ttcattaaaaaagaagggcaaaagcaggtgaatgtactggttgcgacttcgggggatacc
ggtagtgctgtagccaatggcttcctcggagtggaaggtattcatgtgtatgtgctttat
ccgaaaggaaaagtcagtgaaattcaggaaaagcagttcactactctggggcggaatatc
acagcgttagaagtggacggtacttttgatgactgtcaggcattggttaagaatgcgttt
atggatgctgatttgaatgcgcacatgaagttgacttctgccaactccatcaatgtggct
cgtttcctgccacaggcattttattacttctatgcctacgcacagttaaagaaagaagga
aaagcggatcatctggtagtgtgcgtacctagcggaaactttggtaatatcaccgccgga
ctatttggtaaacgcatgggcttgcctgtcaagcgttttattgcagccaataaccggaat
gatattttctaccaatacttacagaccggaaaatacaatcctcgtccttccatagctact
attgccaatgcaatggatgtgggagatccaagtaattttgcccgtgtactggcattgtac
ggtaacagtcatgctgccataacagcggatatctctggtgcgacttatgcggatgaacag
attcgtgaaacggtgggtgaggtatatcgggaaaccggttacttgctcgatccgcatgga
gcctgcggttatcgtgctttatccgaaggattgtcccccagcgaaacgggtattttcctg
gaaacggcacatccggctaaattcctggaaactgtggaaggcatcattggcgacaaagtg
gagattcccgccaaactgcaagcgtttatgaaaggaaccaaacaaagtgttccgatggaa
aaagactttgaaagtttcaaaggctatttgatgaaagaatag

DBGET integrated database retrieval system