KEGG   Bacteroides vulgatus: BVU_2225Help
Entry
BVU_2225          CDS       T00546                                 

Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
bvu  Bacteroides vulgatus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bvu00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bvu00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2876396..2877529
Genome map
AA seq 377 aa AA seqDB search
MNKLFFWVCAVLMTACASYKNDEVLTESGLSNSRFQTEINGEKTDLFVLKNKNKMEVCIT
NYGGRIVSVMVPDKDGIMRDVVLGFDSIQDYIKYPSDFGASIGRYANRINQGRFSLDGIV
YQLPRNNYGHCLHGGPQGFQYRIYRGIQVSDREVKLTYLSKNGEEGFPGNLNCTIIMKLT
DDNAIDIQYEAETDKPTVVNMTNHSYFNLDGDPSKDNSDYLLTLNADYYTPVDSTFMTTG
EIVPVEGTPMDFRLPAVIGTRINQDFEQLRYGNGIDHNWVLNTKGDIHQVCATLESPVTG
IVLNVYTDEPGIQVYCGNFLDGTLTGKKNTIYNFRASVCLETQKYPDTPNKADWPTAVVR
PGEKYQSHCIYKFSVHK
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaataagctgttcttttgggtatgtgcagtccttatgactgcatgtgcttcttataaa
aatgatgaggtcttgactgaatccggtttaagtaacagtcgttttcaaacggagataaat
ggtgagaaaactgatctgtttgtattgaagaataaaaataagatggaagtttgtatcacc
aactatggcggtcgtattgtttctgttatggttcctgataaagatggaataatgagggat
gtagtattgggttttgattccatacaggactatatcaaatatccgtcggattttggagca
agtatagggcgttatgccaaccgtataaatcagggacgtttttcattggatgggatagta
taccaattgcctcgaaacaattacggacattgtttgcatggaggtcctcaaggatttcaa
tatcgtatttatagaggtattcaagtgagtgacagagaggtgaaactgacttacttgtct
aaaaatggtgaagagggttttcctggaaatttgaattgtactattataatgaaattgacg
gacgataatgctattgatattcagtatgaagcagaaacggataaaccgactgttgtaaac
atgactaatcattcttattttaatttagatggagatccgtcaaaagataattctgattat
ttattgactttgaacgcggattattatactcctgttgacagtacttttatgacgactgga
gaaattgttccggttgagggtactcctatggatttcagacttcctgctgtcattggaact
cgtattaatcaagattttgaacaattaagatatgggaatggcattgatcataattgggta
ttgaatactaagggggatattcatcaagtttgtgccacattggagtcacctgttacgggg
attgtactcaatgtttatactgacgagccgggtattcaggtttattgtggtaattttcta
gatgggacattgacgggtaaaaaaaatacaatatataattttcgggcctctgtgtgcttg
gaaacgcaaaaatatcccgatacacctaataaggcagactggcctacggcagtagtgaga
ccaggagaaaaatatcaaagtcattgtatttacaagttttcggtacataaataa

DBGET integrated database retrieval system