KEGG   Bacteroides vulgatus: BVU_2439Help
Entry
BVU_2439          CDS       T00546                                 

Definition
(GenBank) tryptophan synthase beta chain
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bvu  Bacteroides vulgatus
Pathway
bvu00260  Glycine, serine and threonine metabolism
bvu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bvu01100  Metabolic pathways
bvu01110  Biosynthesis of secondary metabolites
bvu01130  Biosynthesis of antibiotics
bvu01230  Biosynthesis of amino acids
Module
bvu_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bvu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BVU_2439
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BVU_2439
Enzymes [BR:bvu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BVU_2439
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP IES5
Motif
Other DBs
NCBI-ProteinID: ABR40097
UniProt: A6L333
Position
complement(3134961..3136325)
Genome map
AA seq 454 aa AA seqDB search
MSTKQKRFILPEDEIPKYWYNIQADMKTKPMPPLNPKTKEALKPEDLYPIFAKELCKQEL
NQTDAWIEIPEAVREMYKYYRSTPLVRAYGLEKALGTPAHIYFKNESVSPIGSHKLNSAL
AQAYYCKEEGVTNVTTETGAGQWGAALSYAAKVFGLEAAVYQVKISYNQKPYRRSIMQTF
GATVTASPSMSTRAGKDIITRNPNYQGSLGTAISEAIELAMSTPNCKYTLGSVLSHVTLH
QTVIGLEAEKQMEMAGEYPDMIIGCFGGGSNFGGICFPFMRHTILNGKQTRYIAAEPASC
PKLTRGKFQYDFGDEAGYTPLLPMFTLGHNFSPANIHAGGLRYHGAGVIVSQLLKDNLME
AVDIQQLESFQAGCLFAQAEGIIPAPESCHAIAAAVREANKCKESGEEKVILFNLSGHGL
IDMASYDQYLAGNLMNYELKDEDIQKNLDEIKDM
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgagcacaaaacagaaacgttttatcttaccagaggatgaaattcctaaatactggtac
aacatacaggcagacatgaagaccaaacccatgccgccgttgaaccctaaaaccaaagaa
gcgctgaaaccggaagacctctaccccatttttgccaaagaactttgcaaacaggaatta
aaccagacagacgcatggattgaaattcccgaagcagtgcgtgaaatgtacaaatactat
cgcagcacaccattggtacgtgcctacggactggaaaaagcactagggactcccgcacat
atttatttcaaaaatgaaagtgtcagccccatcggatcccacaaactgaactcggctctg
gcccaggcatattattgcaaggaagaaggcgtaaccaatgtcactacagaaaccggtgcc
ggacaatggggcgccgctctatcgtatgccgcaaaggtattcgggctggaagctgccgtt
tatcaagtaaagatcagctataatcagaagccctatcgccgcagcatcatgcagacattc
ggagcaacggtcaccgcctctccatccatgtctacccgtgccggcaaggatatcattacc
cgtaatcccaattatcaaggttcactgggaacagccatctccgaagctatcgaactggca
atgagcactcccaactgtaaatatacactagggtcggtattaagccatgtcacactgcat
caaacggttatcggtctggaagccgaaaagcaaatggaaatggcaggcgaatatcccgac
atgattatcggttgctttggtggcggttccaattttggaggaatctgcttcccctttatg
cgccacactatcctgaatgggaaacaaacccgatacattgctgccgaaccggcttcgtgc
ccgaaactgacccgtggtaaattccagtatgactttggcgacgaagccggatataccccg
ttgctgcccatgtttacactggggcataatttctctccggccaatatccatgcgggaggt
ctccgttatcacggtgcaggtgtcatcgtttcacaattattgaaagacaatctgatggaa
gcggttgatatccagcaattagaatccttccaggctggttgtttgttcgcacaagcagaa
ggaatcattccggctcccgaatcgtgccatgccatcgccgccgctgtacgcgaggcgaac
aagtgcaaagaatccggtgaagagaaagtgatcctgttcaacctttcaggtcacgggctg
attgatatggcctcatacgaccaatacctggcaggtaacttgatgaattatgagttaaaa
gacgaagatatccagaagaacttggatgaaataaaagacatgtaa

DBGET integrated database retrieval system