KEGG   Bacteroides vulgatus: BVU_2775Help
Entry
BVU_2775          CDS       T00546                                 

Definition
(GenBank) glycosyltransferase family 4
Organism
bvu  Bacteroides vulgatus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3544274..3545539
Genome map
AA seq 421 aa AA seqDB search
MKVLMFGWEFPPKIYGGLAVASYGITKGLSLQGDMETTFCLPKPCGDEEKFLNIIGMNQV
PIVWRDVDYDYLKSRLSTSTPEQYYAFRDHIYSDFSYMHVNDLGCMEFAGGYPGNLHDEI
NNFSIIAGVVARQQEFDIIHAHDWLTYPAGVHAKLVSGKPLCIHVHATDFDRSRGKVNPT
VYAMEKNGMDHADCIMCVSELTRQTVIHQYHQDPRKCFAMHNAVYPLSQDLLDIPRPDHS
KEKVVTFLGRITMQKGPEYFVEAAALVLKRTRNIRFVMAGSGDMLDAMINLAAERGIADR
FHFPGFQRGRQVYEAYKNSDVFVMPSVSEPFGIAPLEAMQCGTPSIISKQSGCGEILDKV
IKTDYWDINAMADAIYSICTNPSLFQYLQEEGKKEVDGITWEKVGLRIRALYEQVLKNYG
K
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtattaatgtttggatgggaatttcctcccaaaatatatggtggtcttgctgta
gcatcttacggtataacaaaaggtctgagtctgcaaggtgatatggaaacaaccttctgt
ttgcccaaaccttgtggcgacgaagaaaagtttctgaacattataggcatgaaccaagtg
cccattgtgtggcgtgatgtggattatgattacttaaagtcacgtctttcgacttcgact
ccggaacagtattatgctttccgtgatcatatctattctgatttctcatatatgcacgtc
aatgatctggggtgtatggagtttgccggcggctatccgggaaaccttcatgatgagatc
aataacttttctattattgccggtgtggttgcgcgccagcaagaatttgatattatccat
gcgcacgactggctgacttatccggctggtgtgcatgccaagctggtaagtggcaaacct
ttgtgcatccatgtgcatgctactgattttgaccgttcgcgcggtaaagtgaatcctaca
gtatatgctatggaaaagaatggcatggatcatgccgactgtattatgtgtgtgtccgag
ctgacccgtcagactgttattcaccaatatcatcaagacccgcgcaaatgttttgccatg
cacaatgccgtttatccgctttcgcaagatttgctggacattcctcgtcctgatcactcg
aaagaaaaagtggtgactttcctggggcgtatcacgatgcagaaaggacccgagtatttt
gtggaagccgccgcattggtcttgaagcgtacccgtaacatccgttttgtaatggcagga
tcgggagacatgctggacgccatgatcaatctggctgcggaacgaggtattgcagaccgt
tttcatttcccggggttccagcgtgggcgtcaggtttatgaagcatataaaaacagtgat
gtattcgtaatgccttccgtgtcagaaccttttggtattgctcctttagaggctatgcag
tgcggaactccttctatcatctcaaagcaatcgggttgcggtgaaattttggataaagta
atcaagacagattattgggatatcaacgctatggccgatgccatctattctatttgtacg
aatccttctcttttccaatatctgcaggaagaaggaaagaaagaggtggatggcattaca
tgggagaaagtcggcttgagaatccgtgccctctatgagcaggtgttaaaaaactatggt
aaataa

DBGET integrated database retrieval system