KEGG   Bacteroides vulgatus: BVU_2776Help
Entry
BVU_2776          CDS       T00546                                 

Definition
(GenBank) glycoside hydrolase family 57, candidate alpha-glycosidase
  KO
K07405  
alpha-amylase [EC:3.2.1.1]
Organism
bvu  Bacteroides vulgatus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bvu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BVU_2776
Enzymes [BR:bvu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     BVU_2776
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3545558..3546970
Genome map
AA seq 470 aa AA seqDB search
MKTICLYFEIHQIIHLKRYRCFDIGRDHYYYDDYENERGISDIAERSYIPALSALIEMAK
NHGDTFKVALSISGVALEQLEVHAPGVIELLHQLNETGCCEFLCEPYSHGLSSLANEDCF
REEVERMRTKIKQIFGKEPKVFRNSSLIYSNDIGATIADMGFKGMLTEGAKHILGWKSPH
YLYHCAMNPNLKLLLRDFKLSDDISLRFSNSEWNEYPLFADKYIDWIAALPEEEQVINIF
MELSALGIAQPLSSNILEFMKALPVCAKERGVTFSTPTDIITKLKSVDQVDVPYPMSWID
EERDISPWLGNVMQREAFNKLYSVAERVHLCDDRRIKQDWDYLQASNNFRFMTTKNTGIW
LNRGIYDSPYDAFTNYMNILGDFISRVNSLYPVDMDNEELNSLLTTIKNQGEELVALNKE
VERLQAKLEKAEGKKAPAVKKEPAAKKPAAAKKTTAKKPVAKKAASKKEE
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaatatgtctttattttgaaatacatcaaattatccatctgaaacgctatcgc
tgttttgatataggccgtgaccattattattatgatgattatgaaaatgagcgcggcatc
agtgatatagccgaacgctcgtatattcctgcgctgagtgcgttgattgaaatggcaaag
aatcacggtgatactttcaaggtggctttgtctatctcgggtgtggcgctggaacagttg
gaagtgcatgcgcccggtgtaatcgagttgttgcatcagttgaatgagaccggatgttgc
gaattcttgtgcgaaccttattctcacggtctttcctcattggctaatgaagattgtttc
cgcgaagaagtggaacgtatgcgtaccaagattaaacaaatatttggcaaggagccgaag
gtattccgtaactccagcttgatttattcgaatgatattggcgctacgatagccgatatg
ggctttaaaggtatgttgactgaaggcgcgaaacatattttgggttggaagagcccgcac
tacctgtatcattgtgccatgaatccgaacttgaagttattgcttcgcgatttcaaattg
tctgatgacatcagcctgcgtttctctaattccgaatggaatgaatatccgttgtttgcc
gacaaatatatagattggattgcagctttgccggaggaggagcaggttatcaatattttc
atggaactttctgctttgggtatcgcccagccattgtcttccaatattttggaatttatg
aaagcactgcctgtctgcgcaaaagaaagaggggttactttctctactccgaccgatatc
attaccaaactgaaatctgtggatcaggtggatgttccttatcctatgtcatggatagac
gaggaacgcgatatcagtccgtggttaggcaatgtgatgcagcgtgaggctttcaataaa
ctttatagtgtggcagaacgtgttcatttgtgcgatgatcgccgtattaagcaggattgg
gattatttgcaggcaagtaataatttccgcttcatgaccactaagaataccggtatttgg
ttgaatcgtggtatttatgattctccgtatgatgctttcaccaactacatgaacattttg
ggtgattttataagtcgtgtcaattcgttgtatccggtagatatggataacgaagaatta
aattcgttgcttactaccattaagaatcagggcgaggaattggtggctttgaacaaggaa
gtggagagattgcaggctaaactggagaaagctgaaggcaaaaaggctcctgccgtaaag
aaagaacctgctgccaagaaaccggcggcggccaagaaaacgacggcaaagaagccggtt
gccaagaaagctgcttcgaagaaagaagaataa

DBGET integrated database retrieval system