KEGG   Bacteroides vulgatus: BVU_2780Help
Entry
BVU_2780          CDS       T00546                                 

Definition
(GenBank) 8-amino-7-oxononanoate synthase
  KO
K00652  
8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
bvu  Bacteroides vulgatus
Pathway
Biotin metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bvu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BVU_2780
Enzymes [BR:bvu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     BVU_2780
Amino acid related enzymes [BR:bvu01007]
 Aminotransferase (transaminase)
  Class II
   BVU_2780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3549780..3550949
Genome map
AA seq 389 aa AA seqDB search
MGKIEKMSSLTDWERELALLENKSNLRKLPVIRHLGKEVEVNGKVMLNLSSNDYLGLAAY
LPLRTEFLQSLTPDTFLPSSSSSRLLTGNFNIYVQIEDLLARLFRKESALVFNSGYHMNA
GILPAVSDARTLILADKLVHASIIDGIRLSAAKCIRYRHNRYDQLEQLLVSNHAGYDRII
IVTESIFSMDGDEADLRRLVTLKQQYDNVLLYVDEAHAVGVRGMHGLGCAEEQDCVADID
FLCGTFGKALASVGGYIVCSKTIRDYLINKMRTFIFTTALPPVNLLWTFFILEHLDSFSF
RRERLKRISSLLKDALVKKGYACPSTSHILPMTIGDSGDTVLKADFLQRKGFYALPVRPP
TVPEGTSRIRFSLTADITEEEIKSLIELI
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
ttgggaaaaatagaaaaaatgagttcattaacagactgggaaagagaattagccctgctt
gaaaataaaagtaatcttcgtaagttgcctgttatccgccatttgggaaaagaggtggag
gtgaatggaaaagtgatgcttaacctttcatccaacgattatctgggattggctgcttat
ctgccattacgtacggaattcttgcaaagtcttactcccgacacttttcttccttcctct
tcatcctctcggctgctgacaggaaattttaatatctatgttcagatagaggatttgctt
gcccgactgtttcggaaggaaagcgcgttggtttttaatagtggttatcacatgaatgcc
ggtattcttcctgcagtgagcgatgctcgtacattgattcttgccgataaactggtacat
gccagcattattgacggcattcgtttatcggcggccaagtgtatccggtaccggcataac
cgatatgaccaattggaacagttgctggtttccaatcatgccgggtatgatagaataatt
attgtaaccgaaagtattttcagtatggacggtgatgaggccgatctccgccgtttggtc
actttgaagcaacaatatgataatgtattgctgtatgtggatgaagcgcatgctgtaggg
gtgcgggggatgcatggcctggggtgtgcggaagaacaggattgtgtggctgacatcgat
tttttatgtggaacttttggtaaagcgttggcctcagtaggaggctatattgtttgttcg
aagaccatccgtgattatttgatcaataaaatgcgtacattcatatttacaacggctctt
cctcctgtcaacttgctatggacattctttatcctggagcatttggacagtttcagcttc
cggagggaaaggttgaagagaatatcctctcttttgaaagacgcgttggtaaagaaaggc
tacgcttgtccttctaccagccatattctgccaatgacgataggcgatagcggtgatacg
gtgttaaaggccgatttcttgcagcgtaaaggtttttatgcgttgccggtgcgtcctccc
actgtgcccgaaggaacatcgcgtatccgtttttcgttgacagcggatattactgaagaa
gaaataaaaagtctgatagaattgatatga

DBGET integrated database retrieval system