KEGG   Bacteroides vulgatus: BVU_2783Help
Entry
BVU_2783          CDS       T00546                                 

Definition
(GenBank) dethiobiotin synthetase
  KO
K01935  
dethiobiotin synthetase [EC:6.3.3.3]
Organism
bvu  Bacteroides vulgatus
Pathway
Biotin metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bvu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BVU_2783
Enzymes [BR:bvu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.3  Cyclo-ligases
    6.3.3.3  dethiobiotin synthase
     BVU_2783
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3552381..3553025
Genome map
AA seq 214 aa AA seqDB search
MKQNVFFVSGIDTNIGKSYATAYLAHLWNKQGCRTITQKFIQTGNPEGYSEDIELHRRLM
GMEYLPEDEQGLTKPEIFSYPASPHLASRIDNRAIDFDKIKHATEVLSERYDAVLVEGAG
GLMVPLTEDNLTIDYVQESGYPLVFVTSGRLGSINHTLLSFEAIERRGIKLHTVMYNLFP
EGEDKIIQADTETYICRYIEKHFPDTAFVKVPCL
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagaatgtatttttcgtaagtggtattgatacaaatattggtaaaagttatgcc
acggcctatctggcacatctttggaacaaacaaggatgtcgtactattactcaaaaattc
atacagacaggaaatccggaaggttattcggaggatattgagttgcatcgtcgtctgatg
gggatggagtatttgcctgaggatgagcagggacttaccaaacctgaaatattttcttat
ccggcttctccccatttggcttcacgaatagataaccgcgccattgattttgataaaata
aagcatgccacggaggtgctgagtgagcgctatgatgctgttttagtagaaggagccggg
gggctgatggtgccgttgacagaagataatctgactatagactatgttcaggaatcgggt
tatcccttagtttttgttacttcgggacgattgggaagtatcaaccatacattattgagt
tttgaggctatagaacggagagggataaagcttcatacagtgatgtacaatctgtttccc
gaaggagaggataaaatcattcaagcagatacagaaacttatatttgtcgttatatagag
aagcatttcccggatacagcatttgtgaaggtaccttgcttgtaa

DBGET integrated database retrieval system