KEGG   Bacteroides vulgatus: BVU_2789Help
Entry
BVU_2789          CDS       T00546                                 

Definition
(GenBank) sodium-dependent multivitamin transporter
Organism
bvu  Bacteroides vulgatus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3557712..3559145
Genome map
AA seq 477 aa AA seqDB search
MHIIDIIVFLLFTGGVVAFGCSFFKKKGTSEEFTSAGRSLPGWVVGMSIFATYVSSISYL
GYPGKAFSGDWNAFVFSLSIPIASYFAARYFVPFYRSQDSISAYSFLENRFGPWARIYAS
SCYLLTQIARTGSILYLLALPMNVLLGWHIQTIIVVTSVAIVLYSMLGGMKAVIWTEAIQ
GIILIGGALVCMFILLFDMPGGPVQTFSIAMEDGKFSLGSFGSSLSESTFWVCLIYGIFT
NLQNYGIDQSYVQRYHTAKNEKEAKFSALFGGYLFIPVSAVFFMIGTGLYAFYKVHPGIL
PDGVGADYVFPFFIVNELPVGLTGLLIASIFAAGMSTIATSVTSSSTIILTDYYQRFRKH
AGNRERMLVLKLSSVGVGVAGILVAFAFMSVQSALDAWWALASIFSGGMLGLFLLGYISK
KARNFDAVLGVVCGVILVCWIVISPFVHANLAIVFGTLLIFLVGFLSANLLNKRRCK
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgcatatcattgatataatcgtctttttgttgtttaccggcggagtcgtggccttcggt
tgttctttctttaagaagaaaggtacctccgaggagttcacttctgccggaagaagtttg
cccggctgggtggtggggatgtccattttcgccacgtatgtcagcagtatcagttatctg
ggatatccgggaaaggccttttcgggagattggaatgcatttgtattcagtctttctatt
cctatcgcctcttattttgcggctcgttactttgtgcctttttaccggagtcaggacagc
atatcggcttatagctttttggaaaaccgtttcggtccttgggcacgtatatatgcttcg
tcctgctatctgctcacccagatagcacgtacagggtctatcctgtatttgttggcgttg
cccatgaatgtattgttgggatggcatatccagaccattattgttgtaaccagtgtggct
attgtgctttattccatgttgggtggcatgaaggctgtcatttggacagaggccatacag
ggaattattctgatcggaggtgcgttggtatgtatgtttattttgctttttgatatgccc
ggaggtccggtgcagactttctccatcgccatggaagatggtaaattcagcttgggaagc
tttggaagcagtttaagtgagtccactttttgggtgtgtctgatttatggtatatttact
aatttgcagaactatggtatagaccagagttatgtgcaacgttatcatacggcgaagaat
gagaaggaggctaagttttcggccttgttcggaggatatttgtttattcccgtttcggcc
gttttctttatgatagggactggactgtatgcgttctataaagtgcatccggggatcttg
cccgacggggtgggggcggattatgtctttccgttttttatagtcaatgagttgccggtg
gggttgacaggcctgctgattgcttctatctttgccgcaggtatgagtaccattgcgacc
agtgtcactagttcgtctaccatcattctgacggattattatcagcggttccgcaaacat
gccggaaacagggagcggatgttggtgctgaaactctccagtgtaggagtgggagtggca
gggattctggtggcttttgcctttatgagtgtgcaaagtgcgctggatgcctggtgggcg
ttggcgtctattttcagcggaggcatgttgggactgtttctattggggtatatttcgaag
aaagcacgtaattttgatgcggtactgggagtcgtttgtggagtaattctggtttgttgg
attgtgatatccccctttgtacatgccaatctggctatcgtgttcgggacgttgctgata
tttttggtgggattcctgagtgctaatctgcttaataagagaagatgtaagtag

DBGET integrated database retrieval system