KEGG   Bacteroides vulgatus: BVU_2793Help
Entry
BVU_2793          CDS       T00546                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bvu  Bacteroides vulgatus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3563158..3564327
Genome map
AA seq 389 aa AA seqDB search
MKRIMLVCLTALAVSGTYSLYAQSSGSDFMVGDKSLFEEVTGIKKKTDKFNLYLNMHGDF
NMKWNDSGFDQGAFEMKQLRIEMKGDINDWLSYRYRQRLNRGNDGSGNIDNVPTSIDWAG
VGIRLNKFSFFAGKQCVSYGGIEFDLNPIDIYEYSDMIEHMSNFMTGLNVAYNYNPYQQI
QFQVLNSLNGPSEEMYGDLERTKLPLVYTLNWNGNFLDVFKTRWSASVMNETKGEKMYYY
ALGNEFNFSPKWHAYFDWMYSREGVDRKGIITNIVGTDNQAHNAFNAEYMSYVLHVNYRF
APKWNLFAKGMYETASVYKASDEVEKGKYRTAWGYAGGIEFYPMESNLHFFLAYVGRSYK
YTDRAKALGEDNFSTHRVSVGFIWQMPVF
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaataatgttagtatgcctgacagcccttgctgtctcaggtacttactcttta
tatgcccaatcttccggaagtgatttcatggtcggtgacaaaagcctgtttgaagaagtc
accggtatcaagaagaaaacggacaagttcaatctctatcttaatatgcacggtgatttc
aacatgaaatggaatgattccggatttgatcagggcgcattcgaaatgaagcagctccgt
atcgaaatgaagggggatatcaatgattggttgagttaccgttaccgtcagcgtctgaat
cggggtaacgatggttccggcaatatagataatgtacctaccagcatagattgggcagga
gtaggcatcagattaaataagttctcattttttgccggaaagcaatgtgtctcgtatggt
ggtatagaatttgatttgaatccgattgatatttacgaatatagtgacatgatagagcac
atgagtaacttcatgaccggtttgaatgtggcatacaactataatccttatcagcagata
caatttcaggtattgaacagcctgaacgggccgtccgaggagatgtatggggatttggaa
cgtaccaaactgccgttagtttataccttgaactggaacggaaatttcctggatgttttc
aaaacccgttggtctgcctctgttatgaacgaaacgaagggcgaaaagatgtattattac
gctttgggtaatgaatttaatttcagccctaaatggcatgcctattttgactggatgtat
tctcgtgaaggagtagaccgtaaagggattataactaacatcgtaggaactgataatcag
gcacacaatgcttttaatgccgaatatatgtcctatgtgttgcatgtgaattatcgtttt
gccccaaagtggaacttgtttgcaaaaggaatgtatgaaactgcttccgtttataaggca
agtgatgaagtggaaaaagggaaatatcgcacggcatggggatatgcaggaggtatagaa
ttttatccgatggagagcaatctgcacttcttcctggcatacgtggggcgttcctataaa
tataccgatcgtgcaaaggcgttgggtgaggacaatttcagtacccatcgtgtgtcagtg
ggattcatttggcagatgcctgtattctag

DBGET integrated database retrieval system