KEGG   Bacteroides vulgatus: BVU_2795Help
Entry
BVU_2795          CDS       T00546                                 

Definition
(GenBank) 6-phosphogluconate dehydrogenase,decarboxylating
  KO
K00033  
6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
bvu  Bacteroides vulgatus
Pathway
Pentose phosphate pathway
Glutathione metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:bvu00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BVU_2795
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BVU_2795
Enzymes [BR:bvu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     BVU_2795
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     BVU_2795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3565795..3567231
Genome map
AA seq 478 aa AA seqDB search
MEKADIGLIGLGVMGQNLALNLANKGWKVVVWNRTVPGKEENVVEHFIANRAKGKGIIGS
NELTDFVEALKTPRVILLMVQAGPAVDELTGKLFPLMEKGDILIDGGNSYYEDTERRVKE
LYDKGMYFVGCGISGGEEGALHGASIMPGGAQEAWSVIQPMLKSIAAKAEDGTPCCEWVG
PGGAGHYVKMVHNGIEYGDMQLIAETYFAMKHLLALKNEQMADIFEQWDKGRLHSYLIEI
TSAILRHKEEGGDYLLDNILDAAGQKGTGRWSVINSLQLNTPLGVIAEAVFARNLSAEKN
LRVLMSKHYMHVENHPVYNYQDTVIGLESTLYAARLTGYAQGFALMCTASEQYGWKLNLS
TIALLWRAGCIIRSAFLNDIAEAYHRAPGLSHLLLDEHFGREVMEALPAWKKYIGVMLRE
GLPVPVLSAALNYFLGLTTNRSPANMIQAMRDYFGAHTFERVDSPRGEFFHEHWEDNY
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaggcagatataggattaatcggattaggtgtgatggggcagaaccttgctctg
aatcttgccaacaagggatggaaggttgtagtatggaaccgtaccgttcctggaaaagaa
gaaaatgtagtggaacactttatagccaaccgcgccaaaggaaaaggcatcataggcagt
aatgaactgacagattttgtcgaagcactgaaaactccgcgtgtcatccttttgatggta
caggcgggtcccgctgtcgatgaactgacgggcaagctgtttcctttgatggaaaagggt
gatatcctcattgacggaggcaactcttattatgaagatacggaacgtcgtgtaaaggaa
ctttatgataaaggaatgtactttgtaggttgcggcatttcaggaggtgaggagggtgct
ttgcatggagcgtccatcatgcccggtggtgcgcaagaggcatggtcagtcattcagccg
atgctgaaaagtattgcggcaaaagctgaggatggtactccgtgttgtgagtgggtaggt
cccggtggcgcaggccactatgtaaaaatggtgcataatggcatagaatatggggatatg
cagctgattgctgaaacttatttcgccatgaagcacctgctggcgttgaagaatgaacag
atggcggatatttttgaacaatgggacaaaggacgtctgcatagttacctgatagagatt
acttcggccattctgcgtcataaagaagaaggaggcgattatttgctcgataacattctg
gatgctgcgggacaaaaaggaacgggtcgctggagtgtcattaactccctacaactaaat
acaccactgggcgtgattgccgaggcggtttttgcccgtaatctgtcggcagagaagaac
ttgcgcgtgctgatgtccaaacattatatgcatgtggagaatcatccggtatataattat
caggatacggtgatcggattggaaagtaccttatatgcggctcgtctgacaggctatgcg
caagggtttgctctgatgtgcactgccagtgagcaatatggctggaagttgaatctttcc
actatcgcgctgttgtggcgcgccggatgcattattcgttctgcttttctgaacgacatt
gccgaggcctatcaccgtgcaccgggattgtcgcatctgttgctggacgagcatttcgga
cgggaagtaatggaagccctgcccgcgtggaagaaatacatcggtgtcatgttgagagaa
gggttgcccgtacctgtactttccgcagcgttgaattattttctaggtttgaccaccaac
cgttccccagccaatatgattcaagcgatgcgtgattatttcggagctcataccttcgag
cgtgtggacagtccacggggggaatttttccacgaacattgggaagacaactattga

DBGET integrated database retrieval system