KEGG   Bacteroides vulgatus: BVU_2796Help
Entry
BVU_2796          CDS       T00546                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
bvu  Bacteroides vulgatus
Pathway
bvu00030  Pentose phosphate pathway
bvu00480  Glutathione metabolism
bvu01100  Metabolic pathways
bvu01110  Biosynthesis of secondary metabolites
bvu01120  Microbial metabolism in diverse environments
bvu01130  Biosynthesis of antibiotics
bvu01200  Carbon metabolism
Module
bvu_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bvu_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:bvu00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BVU_2796
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BVU_2796
Enzymes [BR:bvu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     BVU_2796
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     BVU_2796
Exosome [BR:bvu04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   BVU_2796
  Exosomal proteins of colorectal cancer cells
   BVU_2796
  Exosomal proteins of bladder cancer cells
   BVU_2796
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N Exotox-A_cataly
Motif
Other DBs
NCBI-ProteinID: ABR40442
UniProt: A6L428
Position
3567280..3568788
Genome map
AA seq 502 aa AA seqDB search
MSLPHSLFLVIFGASGDLTRRKLMPALIKIHNGKRFPEHFAIIGCARTAYTDETYRAYLK
EELIKFGFLTKEEMETLDDFLSTVHYQSMDPADETTYFLLNDRLKELSPQYENNGNYLFY
LATPPLLYELIPKCLHDAGLLKKPGLKRIIVEKPFGYDLASAQKLNKIYAAYFKEEDIYR
IDHFLGKETVQNIMVTRFGSTIYEPIWNRNYIDYVEITAVENMGIGTRGGYYDGAGALRD
MVQNHLMQLLAITAMEPPAKFDKNGFRNEVIKVYQSLRPLTDKYIRDNVIRGQYIAGDDR
IGYREEKNVRPDSRTDTYVAMCLYVDNWRWQGVPFYIRTGKQMPTKVTEIVVHFKPAPMQ
MFQMKEGFYKGEELIIRIQPDEGILQRIAMKEPGAGFYMGTMEMDFSYDQHDQETGDAYV
RLLEDSLVGDPTLFTRSDAVDESWTYFDKILDYWKKHPETPLYGYPAGTWGPKEADVLIN
RSHSEWTNPCKNLTHSNLYCKL
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgagtttaccacatagtttatttttggtcatcttcggtgcatccggtgatttaacccgg
cgcaaactgatgcctgccttgataaagatacataacgggaaacgcttccccgagcatttt
gccattatcggctgtgcccgtactgcatacacggacgagacctatcgtgcctatctgaaa
gaagaactgataaaattcggttttcttactaaagaggaaatggaaacattggacgatttt
ctctctactgttcattaccagtccatggacccggctgacgaaaccacttattttctgttg
aatgaccgtttgaaggagctttcgcctcaatatgagaataatgggaactatttgttctat
ctggcaactccgcccttgctttatgaattgattccgaaatgtctgcatgatgcgggcttg
ttgaaaaagcctggattaaagcgtatcattgtcgagaagcctttcggatacgacctggct
tccgctcagaaactaaataaaatctatgccgcttattttaaagaagaggatatctaccgc
atcgatcattttctgggcaaggaaacggtgcagaatattatggtgacccgttttggaagt
actatttacgaaccgatatggaaccgtaactatatagattatgtagaaatcactgcggtg
gaaaatatgggtataggtactcgcggaggatattatgacggggcgggagctctgcgcgat
atggtacagaaccatttgatgcagttgcttgctattactgccatggaaccaccggccaag
tttgacaagaatggtttccgtaacgaggtgatcaaggtctaccaatcccttcgtccgctg
actgataagtatatccgtgataatgtcatccgcggacaatatattgctggtgatgaccgt
atcggttatcgtgaagaaaagaatgttcgtcctgattcccgtacagatacctacgtggcg
atgtgtctgtatgtggataactggcgttggcagggagtgcctttttatatccgtaccgga
aagcagatgcctaccaaggtgaccgaaattgtggttcatttcaaacctgctcctatgcag
atgttccaaatgaaggaaggcttttacaaaggtgaggaactgattatccgtattcaaccc
gacgagggaattcttcagcgcatagccatgaaagaacctggtgccggtttctatatggga
accatggagatggacttcagctatgaccagcacgatcaggaaacgggggatgcgtatgta
cgcctgttggaagacagtctggtgggtgatcctacactttttacccgttccgatgctgtg
gacgagagctggacttactttgataagattctggattattggaagaagcatcccgaaact
cctctttatgggtatcctgcaggaacatggggaccgaaagaagcggatgtattgatcaac
cgcagtcattccgaatggacaaacccgtgcaagaatctgacacattccaatttatactgt
aaattgtaa

DBGET integrated database retrieval system