KEGG   Bacteroides vulgatus: BVU_2797Help
Entry
BVU_2797          CDS       T00546                                 

Definition
(GenBank) 6-phosphogluconolactonase
  KO
K01057  
6-phosphogluconolactonase [EC:3.1.1.31]
Organism
bvu  Bacteroides vulgatus
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:bvu00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BVU_2797
Enzymes [BR:bvu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     BVU_2797
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3568850..3569554
Genome map
AA seq 234 aa AA seqDB search
MIDHNFYASPVQASQTLITHILEAMDKELERPFTIALSGGTTPATLFEVWEREYAAYTPW
SRIYFYWVDERCVPPGDDQSNFGLAYRLLFSKVGIPASHCYRIVGEGAPEEEAKQYSSIV
KTTVPTVDGVPVFDFVLLGIGEDGHTSSIFPDHQELLTAGEPYEVSVNPYNKTVRICMTG
RPLIEARHTCFLVTGENKCSILKEILDKNKEGVYPASYIWHHARNSQLYASLVS
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgattgaccataacttttatgcgtcgcctgtacaagcgtcgcaaaccttgataactcat
atattggaagcgatggataaagagcttgaacggccttttaccattgctctttccggagga
actactcctgccacactttttgaggtttgggagcgtgaatatgccgcatataccccttgg
tcccgtatttatttctattgggtagacgagcgttgtgtgccacctggcgatgatcagagc
aactttggcttggcctatcgtctgttgtttagtaaggtaggtattcccgccagtcattgc
taccgtattgtgggtgagggcgctcccgaagaagaagccaaacagtattcttccatagtc
aagaccaccgttccgaccgtggacggtgtgcctgtttttgattttgtattattagggata
ggagaggacgggcatacatcatccattttccccgaccatcaggaacttcttaccgccggg
gaaccgtatgaggtgtccgtcaatccttataataaaacagtgcgtatatgcatgacggga
cgtcccttgatagaagcccggcatacctgttttctagtgacgggcgagaacaaatgcagt
attttgaaagaaatccttgataaaaacaaggaaggggtctatccggcatcttatatttgg
catcatgcacgtaattcgcaactgtatgcatcacttgtatcataa

DBGET integrated database retrieval system