KEGG   Bacteroides vulgatus: BVU_2803Help
Entry
BVU_2803          CDS       T00546                                 

Definition
(GenBank) ABC transporter permease protein
  KO
K02004  
putative ABC transport system permease protein
Organism
bvu  Bacteroides vulgatus
Module
Putative ABC transport system
Brite
Transporters [BR:bvu02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Putative ABC transporter [MD:M00258]
    BVU_2803
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3576443..3577663
Genome map
AA seq 406 aa AA seqDB search
MNGTNLFKIALRALANNKLRAFLTMLGIIIGVASVIAMLAIGQGSKKSIQQQISEMGSNM
IMIHPGAEMRGGVRQDPSAMQTLKLENYEKLSEECTYLSGISPNVSSSGQLVAGANNYPS
SVSGVSMDYLTIRQLTVEQGEMFTENDIRTAAKVCVIGKTIVDNLFPDGSDPIGKVIRCN
QIPFRVIGVLKSKGYNSMGMDQDDVVLAPYSTVMKRLLAQTYLSGIFASALTEDMTDEAV
DEITTILRREHKLKETDDDDFTIRTQQELSSMLNTTTDLMTTLLACIAGISLVVGGIGIM
NIMYVSVTERTREIGLRMSVGARGVDILSQFLIEAILISITGGLIGVIIGCGASFMIKTI
AHWPVFIQPWSVLLSFLVCTVTGVFFGWYPAKKAADLDPIDALRYE
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgaacggaacgaatctatttaaaatagctctccgggctcttgccaacaacaagctccgc
gctttcctcaccatgttggggatcatcatcggtgtggcatcagtcattgctatgcttgcc
atcggtcagggctcgaaaaagagcatccagcaacaaatctcggagatggggtcaaacatg
attatgattcatccgggagcagagatgcgtggaggggtccgccaagacccttcggccatg
cagacactgaaactggaaaattatgaaaagttgagcgaagagtgtacttatctctccggc
attagtcccaacgtttcttcttcgggacaacttgttgcgggggccaacaactacccgtct
tcggtgagtggtgtaagtatggattatcttaccatacgtcagctcaccgtggaacagggg
gagatgtttaccgagaatgacatccgtacggcagccaaggtttgtgttatcggtaaaacc
attgtcgataatctttttcccgacggatcggatccgatagggaaagtgattcgttgtaat
caaattcctttccgggtaattggtgtgctgaaatcaaaagggtataactcgatgggcatg
gaccaggacgatgtggtactggctccttacagtacggtgatgaaacgattgctggcacag
acttacctaagtggaatttttgcttcggctctgacagaagatatgaccgatgaggctgta
gatgagataacgaccattctgcgtcgtgaacataagctgaaagaaacggatgatgatgac
tttaccatccgcacccagcaggagctgagtagtatgctcaacactacaacagacctgatg
actaccttgttggcttgtattgccggtatatctttggtggtcggtggtatcggtatcatg
aatatcatgtatgtgtctgtaacagagcgtactcgtgaaataggtttgcgtatgtcggtc
ggggctcgaggagtagatatcctgagccagtttttgatagaggctatcctgatcagtatc
acgggggggctgataggagtgattatcggttgtggagccagttttatgattaaaacgata
gcacattggcctgtatttatccagccttggagtgtgttgctttcatttctggtatgtacc
gtcaccggtgtgtttttcggatggtatccggcgaagaaagctgcagatttggatccgata
gacgctttgcgttacgagtag

DBGET integrated database retrieval system