KEGG   Bacteroides vulgatus: BVU_2807Help
Entry
BVU_2807          CDS       T00546                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bvu  Bacteroides vulgatus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3581506..3581928
Genome map
AA seq 140 aa AA seqDB search
MDNLQEKLAELKTYIGKTDEESKARFDSLSAEIKAMKLTDEEKTIFSNFMMQGLEDISNS
MDVIERELRIREQLKEAVEILPLAYIARNYFGKSASWLYQRINGYKVRGKVYTLNHEEIG
IFNRALKEIGEKIGSLSITG
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggataatttacaggaaaaattagcagaactgaaaacctatatagggaaaacggacgaa
gaaagcaaggccagattcgattccttgtctgcggaaataaaggcaatgaagttgacggat
gaagagaaaaccatcttcagtaactttatgatgcagggactggaggatatcagtaacagt
atggatgtcatagaacgggaattaagaatcagggaacagctaaaagaggctgttgagata
ttgcctttggcttatattgctagaaactactttggaaagagtgcatcttggctgtatcag
cgcataaatggatataaggtgcgaggaaaggtctatacgctgaatcatgaggaaataggt
atcttcaaccgtgcactgaaagaaataggagaaaaaataggctcactgtccattactggt
taa

DBGET integrated database retrieval system