KEGG   Bacteroides vulgatus: BVU_2814Help
Entry
BVU_2814          CDS       T00546                                 

Definition
(GenBank) hypothetical protein
Organism
bvu  Bacteroides vulgatus
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3588657..3588896
Genome map
AA seq 79 aa AA seqDB search
MNKGRLTGTDDLNNVLTSGIYEISAPTTGVLNGKDIQYGILIVFSAGQRIQLLGNGLYGN
AYFRTGRDNGRWYDWVSIY
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagggagattaacaggaacagatgacttaaataatgtattaacatcaggaatc
tatgaaattagtgcccctacaacaggggtactaaatgggaaagatattcaatacggaatc
ttaatagtattctcagcaggacaaagaatacagttattaggtaatggcttatacggaaat
gcatattttaggacaggtagagataatggaagatggtatgattgggtatctatatattga

DBGET integrated database retrieval system