KEGG   Bacteroides vulgatus: BVU_2817Help
Entry
BVU_2817          CDS       T00546                                 

Definition
(GenBank) hypothetical protein
Organism
bvu  Bacteroides vulgatus
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3590020..3590592)
Genome map
AA seq 190 aa AA seqDB search
MSDLNLENIVGFKAVDKNGNERQVTVDEMTELVSARIVSAASEISTFAAAAAAGTDEFED
QLPQSDTFSWLRTLDGSKNPTLTSSSAAAKVLGELLGNPKGTKSFSSWSEFTDFVNEMPI
KTIQPFVSNFNAFAGEGFYGNVVQGLVIKQLEDAVFIFGIAIDGTLIFRKRNYPDVSTWE
DPKIIIHSNN
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatttgaatttagaaaatatagttggctttaaagctgtggataaaaacggcaac
gaacgacaggtgaccgtcgatgagatgacagaattagtttccgcacggattgtttccgct
gcatcagaaatatcaacatttgctgccgctgcggcagccggaacagatgagtttgaggac
cagttgccccagtccgacaccttctcttggctccgtactttggacggttccaagaaccca
actttgacatcttcttcggctgccgcgaaagtcctgggagaactgttgggaaatccgaag
ggaacaaaatcgttttcttcatggagtgaatttacggattttgtaaatgaaatgcctata
aaaacaattcaacctttcgtttccaatttcaatgcttttgctggagaaggattctacggt
aatgtcgttcaaggattggttataaaacaattagaagatgctgttttcatcttcggaata
gcaatagacggaacattaatatttagaaaaaggaattatccagacgtttcaacttgggaa
gatcctaagataataattcacagtaataattga

DBGET integrated database retrieval system