KEGG   Bacteroides vulgatus: BVU_2820Help
Entry
BVU_2820          CDS       T00546                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bvu  Bacteroides vulgatus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3591391..3595473)
Genome map
AA seq 1360 aa AA seqDB search
MTELELQELTDKIIAKLKADSLTIDQLTQTNVLTGMDFLELNSGRKVSLDDLRKFIRGYG
IYLEIISKLDNETIPTDNNVFSSLRVLFEISKALEELKKIYLRKDQDDETKYLLKLLGGA
KIGKSLTVGDFITGVQGGYIGEDARAELEALVLRSSLSVPELRFNRQTYFEGYNTISPGG
GLKIKSFVANSDGSYTVTPDLEDGVPLGQKPDDILLGFWHDKSVTTGDFIGFRKIQYRIT
SADYDENTFVMVPRPGYEFVPHNEMRLGQTGNFTDKERQTYIIIDVRDGNCCITLVDNAN
TWDPEPAQMKSWFGKKKGMTINGINCDRFSAVLQDIIMTGLIFQIDEITGSTVRVPIDFP
SWEPGRKYAYYSRVPHNGSTWLCVNDKGTTSEPSENNPDWLVSAAKGDKGDPGLSVIGGG
HWESSKTPYEVNTMVTLAGCVFISKVKTSNPPIKIARFRNGNYRKKKDGGYILAGKSADW
TVHEDWEMLLDGRELKGESITFLGEFASHPSNPKEGDSYRNTADHCTYIYRNGLWMVMVK
DGTDGKDGKGYEWIYTRTNIIGLTPDKPDSKQQDDYIPEGWTDDFLGVDADHQVEWACKR
VKRDGVWSEWSTPAPVHRWSKDGESNIMADLDNEMVSVALTSTGVTTSAQSWTTHVSMWY
GTEKLTLETLTVSTPAGFTASTSKATGAVAISVAAGKSVPEQNTVTITLAAMKNGQLYTR
ELTFKITGVRGGADGSDAVIYSLVTSATMVSKNKNGGYSVASVSCRRMKTVGAVTTATTD
GELKYSRDGAAEVPIGDGVGVASGNFTSSLKFVFYVNGQAVDVETVPMVVDGSDGKDGES
ITAAGHWESANTPYAKNSTVSFAGGSYLSKVETSNPPIKIAKFRNGRLRRKRDGGYILAG
RSANRTVHADWQEMVAPVGPSASYWLDSPVSVINFTSTGTPSPSGFLVTCKQNVAGNVST
CSTLYLAARKYNGSWLAHVGATLSNQISVPATAGYTQFAVRAYKSASDANAWNNNFVAEK
GVGVANDGSIGATGATGAFPRDRGVWASGQTYVWNADYRDKVIYLIGGVYYNFLVKNYGA
SVTAAPTSVNGDSNWEAMQKFVNIATDTLFADGANVAGFMFKDKVLKSFNDKGETLLING
VTGYFKCKNAEITGTITADKGRIGPFSIASGILSSKILYENETNKYVGFNLSAGQIEFYN
ERTFANVRIGGNTQFVTIEGIKYDAGIDIQSPNAMIGMHIKTPSIPLFVEGGNIFLHPNN
DSYVSLRGIVGNWRNISVKASLNNNDDNVMFINRDNIEVTLPPDVPGHTIYFKRMSGGVR
LTGGRILPAPGGQEVSYIDLDFASGFIKCMGNYWVMFYCG
NT seq 4083 nt NT seq  +upstreamnt  +downstreamnt
atgacggaacttgaattacaggaactcaccgataagatcatagctaagctaaaagctgac
agccttactatagaccagttgacacaaaccaatgtgttaaccggcatggattttctggaa
ctgaacagcgggcgcaaagtttcattagatgatttacgcaagttcatccgtggctatggc
atttatcttgagattatttccaaactggataatgaaacaatccccaccgacaacaatgta
ttctcatctcttcgtgtcctgtttgaaatctctaaagcgcttgaagaacttaaaaaaata
tacctacgtaaggatcaggatgatgaaacaaaatatctactaaaactcttgggtggggca
aaaataggtaaaagtcttactgtcggtgactttatcaccggtgttcagggcggttacatc
ggtgaggacgcccgtgccgagctggaggctctggtcctgcgcagctctctgagtgtacca
gaacttcgtttcaaccgtcagacctattttgaaggatataatactataagtcccggcgga
gggctgaagataaaaagctttgtcgccaatagtgacggcagctatactgtcacccctgat
ctggaggatggtgtaccgctgggacagaagccggacgatatcctcctgggcttctggcat
gacaaaagcgtcactaccggtgactttattggtttcagaaaaatacagtaccgtatcact
tccgcagattacgacgagaatacattcgtgatggttccgcgtcccggatatgagttcgtt
ccccataacgagatgcgtctcggacagacggggaacttcaccgacaaggagcgtcagact
tatatcatcatagacgtgcgtgacggtaactgctgcatcacccttgttgacaatgccaac
acctgggacccggagccggcacagatgaagagctggttcggcaagaagaagggtatgacc
atcaacgggatcaactgcgacaggttctcggcagtattgcaggatatcatcatgacggga
ttgatttttcaaattgatgaaattaccggtagcacagtccgcgttcctatcgacttccct
agctgggagccgggcaggaagtatgcgtattattcccgtgtgccccataacggttccaca
tggttgtgcgtcaatgacaagggcactacttccgagccatccgaaaacaatccggactgg
cttgtatcagccgccaaaggtgacaagggtgatccgggactgtctgtaataggtggcggt
cattgggaatcctctaagaccccatacgaggtcaataccatggtcactttggcgggctgt
gtttttatctccaaggtgaaaacatccaatcctccgattaaaattgcaaggttcaggaac
ggcaattatcgaaagaaaaaggatggcggttatatccttgccgggaaatcagccgactgg
accgtgcatgaagactgggagatgctgctggacggtcgtgaacttaaaggtgagagtatc
accttcttgggtgagttcgcatcccatccgtccaatcccaaggagggtgacagctaccga
aatacggctgaccattgtacttacatataccggaatggtttgtggatggtcatggtcaaa
gacgggactgacggtaaggacggcaaaggttacgagtggatctacacccgtaccaacatc
atcggccttacccctgacaagccggattcgaagcagcaggatgattatataccggaaggc
tggacagatgattttcttggcgtggatgcagaccatcaggtggaatgggcgtgcaaacgt
gtgaagcgtgatggagtatggagtgaatggagcactccggcccctgtgcaccgttggagt
aaggacggggagtcgaatatcatggccgaccttgacaatgagatggtgagcgtcgctctt
accagtaccggtgttactacttccgcacagtcatggactacccatgtatccatgtggtac
ggtaccgagaaactcacccttgagactttaacagtcagcacgcctgccggtttcacggca
agcacaagcaaggccaccggagcggtggcgatatccgtcgctgccggaaagtcggttccg
gaacagaatacggtcaccatcacactggctgcaatgaagaacgggcagctctatacccgt
gaactgactttcaagataaccggtgtccgtggcggggcggacggttccgatgcggtaatt
tatagccttgtcacttcggccacgatggtcagcaagaacaagaacggcggttacagtgta
gcttcggtatcctgtcggcgtatgaagacagtcggtgcggtcactacggccacaacggac
ggggagttaaagtacagtcgtgacggtgcggccgaggttcccatcggtgatggtgtcggg
gtggcttccggtaattttaccagtagcttgaagttcgtgttctacgtgaacggtcaggcg
gttgatgtcgaaactgtcccgatggttgtggacggcagtgacggaaaggatggtgagagc
atcacagcagccggtcattgggaatccgccaatactccgtatgccaagaacagtacagta
tcgtttgccggaggatcttacttaagcaaggttgaaacctccaaccctccgattaaaatc
gccaagttcagaaacggcagactccgcaggaaaagagacggcggatacatcctcgccggc
agatctgcgaaccggacggtacatgcggactggcaggagatggttgctcccgtcggaccg
tcggcatcctactggctggacagtcctgtcagcgtgatcaacttcacttcaacaggcacg
ccatccccgtctggattccttgtcacttgcaaacagaatgtggcaggcaatgtaagcacg
tgcagcacgctttatctggcagcccgcaaatacaacggaagctggctggctcacgtaggt
gctaccctaagcaatcagatatccgttccagcgacagccggatacacccagtttgccgtc
cgggcttataaatccgcgtcggacgcaaacgcatggaataataattttgtcgctgaaaaa
ggggtgggtgttgcaaatgatggttccataggagcgacaggagcaacaggggcgtttccc
cgtgacagaggcgtatgggcttccggacagacttacgtctggaatgcggattaccgggat
aaggtcatatatctgatagggggagtttattataatttccttgtaaaaaattacggcgct
tccgttaccgctgcacccacatctgtcaacggtgattccaattgggaagctatgcagaag
tttgtgaatatcgccactgacaccctgtttgccgatggtgcgaatgtagccggcttcatg
ttcaaagacaaggttctcaaatcttttaatgacaaaggtgaaactcttcttatcaacggc
gtaaccgggtattttaaatgtaagaatgcagagattacaggaacaatcacagcggataaa
ggacgtatcggtccgttctccatcgcttcgggaatattgtcctcaaagatcctttatgaa
aatgaaacaaataaatacgtcggtttcaatttgtctgccggacaaattgagttttataac
gaaaggacatttgcaaacgtaagaatcgggggaaacacgcagtttgtcaccattgaaggg
attaagtatgatgctggaattgacatacagagtccaaatgccatgatcgggatgcacatc
aagactccgagcattcctctattcgtggagggaggtaacattttccttcatccgaacaat
gacagctatgtttctcttcgtggcatagttggcaactggaggaatatctctgtcaaagct
tcattgaacaacaacgatgataatgtgatgtttattaatagagacaatatagaagtgacg
cttcctccggatgttccgggacatactatatacttcaaacgtatgagcggcggagtaaga
ttgacaggaggacggatcctgcctgctcccggaggacaggaggtgtcttatattgatttg
gattttgcatccggcttcattaagtgtatgggtaattattgggttatgttttattgcgga
taa

DBGET integrated database retrieval system