KEGG   Bacteroides vulgatus: BVU_2830Help
Entry
BVU_2830          CDS       T00546                                 

Definition
(GenBank) hypothetical protein
Organism
bvu  Bacteroides vulgatus
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABR40476
UniProt: A6L462
Position
complement(3606627..3607193)
Genome map
AA seq 188 aa AA seqDB search
MTMDIVDIFRDVVSKASRNLKILCPDGNGGFQEVDNPPLNYIFGNSQYIKDTLDVYSQSE
RQLPLKFPLVALFCPISERRDSRHYYSKSKVSLVIACPSTKDWTNEEREVNSFKNILRPI
YGRLLDVLLEDNRFDWGADDKVRHVYSENYSYGRYGAMTATGQEVSDPIDAIDISSMEIT
INNPNCRR
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgacaatggatatagtggatatctttcgtgatgtagtttccaaggcttcccggaatctt
aagattctatgtcctgacggcaacggagggtttcaggaggtggataatccgccattgaac
tatatcttcgggaacagtcaatatatcaaggatactcttgatgtatacagtcagtctgag
cggcagttgcctttgaagtttcctcttgtcgctttattttgtccgataagtgagagacgt
gacagccggcattactattcaaagtcaaaggtttcattagttatcgcctgcccgtcaacc
aaagattggacaaacgaggaacgcgaggtaaactctttcaagaatatcttgcgcccgatt
tatggaaggttacttgatgtattactcgaagacaaccggtttgactggggagcggatgac
aaagtaaggcatgtttattccgagaactattcttatggcagatacggtgcaatgacagcc
accggacaggaagtgagcgatcctattgatgccattgatatcagctcgatggaaataact
attaataatcccaattgtagaagataa

DBGET integrated database retrieval system