KEGG   Bacteroides vulgatus: BVU_2837Help
Entry
BVU_2837          CDS       T00546                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K07474  
phage terminase small subunit
Organism
bvu  Bacteroides vulgatus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3614497..3615042)
Genome map
AA seq 181 aa AA seqDB search
MTSKEDRPLTLKQENFCQYYVDIEGNASEAYRMAYNASKMKAESVWTEASLLLSNPKVSQ
RINQIKEQRAKDSAVRREAVEKVLYDIVMADPKDLYILDSSTGKVKLKRPDQMPKRIRNA
MKKITNKKGEVSYEFTGKTEAARLLGAWNGWDAEKTINVKNDGDKIGELRIGFDENDKSD
K
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgacatcaaaagaagacagaccactgacactcaaacaagaaaatttctgccaatattat
gtagatatcgaaggcaatgcaagcgaagcctaccgcatggcttacaatgcttccaaaatg
aaggcagaaagtgtatggactgaagccagccttctcttgtcaaacccaaaggtctcccaa
aggataaatcaaattaaggaacaacgtgccaaagattccgcagtcagacgtgaggcggtt
gagaaggttctctatgatattgtaatggctgaccccaaagacttatatatacttgattct
tcaacaggcaaagtaaaattaaagcgacccgaccaaatgcccaaacgtatccggaatgca
atgaagaagataaccaacaagaaaggagaagtttcctatgagttcacaggtaagacagaa
gccgcccggcttcttggtgcatggaacggatgggatgccgaaaagaccatcaatgtaaaa
aatgacggcgataagatcggtgaactgcgcatcggttttgacgaaaacgacaaatcggat
aaatag

DBGET integrated database retrieval system