KEGG   Bacteroides vulgatus: BVU_2838Help
Entry
BVU_2838          CDS       T00546                                 

Definition
(GenBank) putative nucleotide sugar epimerase
Organism
bvu  Bacteroides vulgatus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase RmlD_sub_bind GDP_Man_Dehyd Polysacc_synt_2 3Beta_HSD NAD_binding_4 adh_short DapB_N
Motif
Other DBs
NCBI-ProteinID: ABR40484
UniProt: A6L470
Position
complement(3615138..3615941)
Genome map
AA seq 267 aa AA seqDB search
MKMIVTGSEGFIGKALCQELKRRDVEVIGIDRKNGKDAASICDILKNGDIDCVFHLAAQT
SVFNGNIPQIRKDNIDTFINVADACNRYHVKLVYASSSAAHPCNTTSMYGISKYFNEQYA
SFYCKDATGVRLHNVYGSLPRKRTLLWFLLNRGKVKLYNYGRNIRCFTYIDDAVQGLIYA
YGSHKRLVNVANMQPITVKSFAEIVGSYKSIDIELVETTREHDNSEQVVDRYIFLVPLSY
TSVENGIRKIFAGRRNQTPQNSKTEEG
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgattgtaactggcagcgaaggcttcataggcaaagccctctgtcaggaattg
aaaagacgtgatgttgaagtgatcggaattgaccggaaaaacggcaaggatgccgcaagc
atttgcgacatcctcaaaaacggagatatagactgtgtattccacctggccgcacagact
tccgtattcaatggaaacatcccccaaatccggaaagacaacattgacactttcataaat
gtcgctgatgcctgcaacagatatcatgtaaaattggtatacgcaagttcgtctgccgcc
catccatgcaacacaacctccatgtatggcatatccaaatacttcaacgagcagtacgcc
tcattctattgcaaagacgcgacaggcgtccggcttcataacgtgtacggttccctccca
cgtaaaagaactcttctctggtttttactcaatagaggaaaagtcaaactgtacaactac
ggccggaatatccgttgctttacatacattgatgacgcggtacaaggactcatctatgcc
tacggctcacacaaacgccttgtcaatgtggcgaacatgcaacctatcaccgtaaaaagc
ttcgcagaaattgtgggatcgtataaaagcattgatattgaactggtggagaccacccgt
gaacatgacaattctgaacaagtagtggacaggtacattttcttagtacctttgtcctac
acctccgtagagaatggaatcagaaagatttttgccgggcggagaaaccaaacgccccaa
aattccaagacggaggaaggatag

DBGET integrated database retrieval system