KEGG   Bacteroides vulgatus: BVU_2860Help
Entry
BVU_2860          CDS       T00546                                 

Definition
(GenBank) hypothetical protein
Organism
bvu  Bacteroides vulgatus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDDEXK_1 Cas_Cas4 KGK
Motif
Other DBs
NCBI-ProteinID: ABR40506
UniProt: A6L492
Position
complement(3631070..3631990)
Genome map
AA seq 306 aa AA seqDB search
MIKLVKSPVVFNEENHTYFLGEKQLRGITGMISRQLFPDKYKGVPDHVMRRAADKGSRIH
SQCEFVDSTGFEPESIEAENYLRERMNAGYDALANEYTVSDEEYFASNIDCVWEKEGEIS
LADIKTTYRIDKESLSWQLSIYAYLFERQNPGLKVRNLYGVWLRGDKSELIPVERRSDEE
VMRLMECEVKGEKYLSTEIAPAGNLQLMTAAAVQMLIDIQEELDFAKEQSEQMKEGLKNA
MIENGVNVWDAGRLRASVTPATTGKSFDTKAFQTDYPDLYSKYLKSVEKKASIRITIRKE
KENECE
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgataaaattagtaaagtcccctgtggttttcaatgaagagaaccacacctattttctt
ggagagaaacagctccggggaattaccggtatgatcagccggcagttgtttcccgacaag
tacaaaggcgttcccgaccatgtgatgaggcgtgcggccgacaagggcagccgcatccat
tcacaatgcgaatttgtagactcgacaggattcgagcctgaaagcatcgaggcggagaac
tatttacgtgagcgcatgaatgccggatatgacgcgctggccaacgaatacacagtatcc
gatgaggagtacttcgcatccaacatcgactgtgtatgggaaaaggaaggtgagatcagc
ctggcggatatcaagaccacttaccggatagacaaagaatcccttagctggcagttgtcc
atatacgcatacctctttgagaggcagaatcccggactgaaagtcagaaacctgtacggg
gtctggctccgtggagacaagtccgagcttattcctgttgagcgcaggtctgatgaagaa
gtaatgcgcctcatggaatgcgaagtgaagggtgagaaatacctttccacagaaatagca
cctgccggaaacctgcagttgatgactgcggcggctgtacaaatgcttattgatatccag
gaagagctggattttgccaaggaacagagcgaacagatgaaggaaggactgaaaaacgcc
atgatagagaatggggtgaatgtatgggatgccggacgactgcgtgcttccgtcactccc
gccacaacaggcaagtcattcgacaccaaggcattccagactgactatccggatttgtat
tcaaagtatctgaaatctgtcgaaaagaaagcatctattcgtataaccataagaaaggag
aaagaaaatgagtgtgaataa

DBGET integrated database retrieval system