KEGG   Bacteroides vulgatus: BVU_2873Help
Entry
BVU_2873          CDS       T00546                                 

Definition
(GenBank) putative outer membrane protein
  KO
K05770  
translocator protein
Organism
bvu  Bacteroides vulgatus
Brite
Transporters [BR:bvu02000]
 Other Transporters
  Others
   BVU_2873
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3638817..3639281
Genome map
AA seq 154 aa AA seqDB search
MKRIIPILIAILICFGVGCTASYFQSESILNWYPALEKPSCTPPDIAFPIAWSFIYLCMG
ISIGLIWHIWTIRRQMIIRLFGFQLLFNFTWSIFFFYFRSPLLGFANILVLDVLVIYYMI
ESYPVRKSSAYLFVPYLLWLLLATYLNGYILMYN
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaataatccccatactgattgctatacttatctgttttggtgtaggctgtact
gcttcttattttcagtcggagtccatactcaactggtatcctgcattggaaaaaccttct
tgtacaccccctgatatagcttttcccattgcttggagttttatctatctgtgcatggga
atttctatcgggttgatttggcatatatggacaataagacgacaaatgattatcagatta
ttcggattccagcttctgtttaattttacatggagcattttcttcttttattttcggagt
ccgttgctaggttttgcaaatattctggtgctggatgtgcttgttatttattatatgata
gaaagttatccggtgaggaaatcttcggcatatctttttgttccttatcttttgtggttg
cttcttgccacttatcttaacggctatatattaatgtataattaa

DBGET integrated database retrieval system