KEGG   Bacteroides vulgatus: BVU_2875Help
Entry
BVU_2875          CDS       T00546                                 

Definition
(GenBank) transcriptional regulator
Organism
bvu  Bacteroides vulgatus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3640099..3640710
Genome map
AA seq 203 aa AA seqDB search
MKRTELVHVAVAETSVIVRSGLVAVLKRMPDLIIQPVEITSLEGLQNCMQGHQPDILIIN
PTFGGWFNVDEFKSNYPQASVKCVSLLCSVTDTNLLKGYDESIALYDDIEVLNKKLVDLM
NLGVDETDGEQEALSQREKEIICCVVRGMTNKETAEKLFLSIHTVITHRRNIARKLQIHS
PAGLTIYAIVNKLVELSEVKMNL
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggacagaacttgtgcacgttgcggtggccgaaacttcagtcattgtgcgtagc
ggacttgtggctgtgctgaagcgcatgcctgatcttataatacagccggtggaaataact
tctcttgaaggactgcaaaattgtatgcagggacatcagccggatattctaatcataaat
cctactttcggaggatggtttaacgtggacgagttcaaatcgaactatccacaggcatct
gtcaaatgcgtttctttgttgtgttcagtcacagataccaatctgttgaagggatacgat
gagagtatagcgctatatgatgacatcgaagttttaaataaaaagttagtagacctgatg
aatcttggtgtggatgaaacagatggcgaacaggaagcgttgagccagcgtgagaaagaa
attatttgttgcgtggtacgtgggatgacaaataaggaaacggcggaaaaactgttcctc
tccattcatacggtgataactcaccgtcggaatattgcgcgcaagctacaaatacattca
cctgccggattgactatttacgctatcgtaaataaactggttgaactaagcgaggtgaag
atgaacttataa

DBGET integrated database retrieval system