KEGG   Bacteroides vulgatus: BVU_2876Help
Entry
BVU_2876          CDS       T00546                                 

Definition
(GenBank) oxidoreductase, putative glycolate oxidase
  KO
K18928  
L-lactate dehydrogenase complex protein LldE
Organism
bvu  Bacteroides vulgatus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3641022..3641762
Genome map
AA seq 246 aa AA seqDB search
MKVGLFIPCYINAVYPQVGIASYKLLKSLGVDVDYPLNQTCCGQPMANAGFENKAVDLAR
HFDEQFKNYDYIVGPSASCVVFVRDNYSRLLKEDKHRCASEGKIYDICEFIHDIVKPSSL
KAKFPHKVSLQNSCHGVRLMKLSSASELNIPYFSKLRDLLSLVEGVEVVEPERKDECCGF
GGMFAVEEDAVSVQMGHDKVMRHIATGAEYIVGADSSCLMHQNGIIARDKLPIKTLHIVE
ILAAGL
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaggtttatttattccttgttatatcaatgcggtatatccgcaggtggggata
gcctcgtacaagctgctgaaaagtttgggagtggacgtggattatcctctcaatcagact
tgttgcggccaaccgatggcgaatgcaggtttcgagaataaagcggtagatttggcccgt
cattttgacgaacagtttaagaattacgattatatagtgggcccttcggccagttgcgtc
gtttttgtgcgtgataactacagtcgtctgttgaaagaagacaaacatcggtgtgccagc
gaaggtaagatatatgatatctgtgagtttattcatgatatcgtcaagccttcttcgttg
aaagccaagtttccacataaagtgagtctgcaaaacagttgtcatggagtgagattgatg
aaactttcttctgccagcgaacttaatattccttatttcagcaaattgcgtgatttgctc
tctttagtagaaggagtggaagttgtggaaccggaacgcaaagacgaatgttgcggtttc
ggcggtatgtttgccgtagaggaagatgcggtttccgtgcagatggggcatgacaaggtg
atgcgtcatattgctaccggtgctgaatacattgtgggggccgacagttcgtgcctgatg
catcagaatggtatcattgcccgtgacaaacttcctatcaagacattgcacattgttgaa
atcttagcggcaggattatga

DBGET integrated database retrieval system