KEGG   Bacteroides vulgatus: BVU_2877Help
Entry
BVU_2877          CDS       T00546                                 

Definition
(GenBank) putative electron transport protein
  KO
K18929  
L-lactate dehydrogenase complex protein LldF
Organism
bvu  Bacteroides vulgatus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3641759..3643126
Genome map
AA seq 455 aa AA seqDB search
MSTKHSKAAAEFLKNKKQAAWHDETLWLVRAKRDRLSKEVPEWEELRNMACATKLYSNSH
LDELLVEFENNARANGAHVYWAKDADEYCNIVYNILNQHGVKHFIKSKSMLAEECELNPF
LESKGIEVVESDLGERILQLMHLKPSHIVLPAIHIKREQVGELFEREMGTEKGNFDPTYL
THAARKNLRQKFIHAEAAMTGANFAVASTGEIVVCTNEGNADMGTSQPKLQIAAFGMEKI
VPDRESLGVFTRLLARSATGQPITTYTSHYRKPREGGELHIIIVDNGRSKILADPKHIKT
LNCIRCGACMNTCPVYRRSGGYSYTYFIPGPIGINLGMLKAPLHYYDNVSACSLCYSCSF
VCPAKVDLAEQIYLWRQDLDKLGKADRMKKVMSGGMEFMMKRPSIFNMALKWAPLVNGVP
RFLIYNGLNDWGKGREMPKFAKESFNEMWKKGKVK
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgagtacgaaacattcaaaagcagctgcggagtttctgaaaaacaagaaacaggccgca
tggcatgacgaaacactttggctggttagggcaaagcgtgacagactgagtaaagaagtt
cccgaatgggaggaattgcgtaatatggcatgtgctactaaactatatagtaacagccat
ttggacgaattattggtggagtttgaaaacaatgcgcgtgctaacggagctcatgtctat
tgggcaaaggatgcggatgagtattgtaacattgtctacaatattctgaaccagcacgga
gtgaagcattttataaaaagcaaatccatgttggccgaggagtgtgaacttaatcctttt
ttggaaagcaaagggattgaagtggtagaaagcgacttgggagagcgtatcttgcaattg
atgcatctgaagccgagccatattgtattgcctgctattcatatcaaacgtgaacaggta
ggtgagcttttcgagcgagagatgggtacggagaaaggaaattttgaccctacttacctt
acacatgcagcccggaaaaatctccgtcagaaatttattcatgctgaggcggctatgaca
ggtgctaactttgctgtagcttctactggtgagattgtggtatgtaccaatgaaggaaat
gcggatatgggtacttcccagcctaaattacagattgcggcttttggtatggaaaaaatt
gtgccggatcgtgaatcattgggagtgttcacccgtttgttggcccgttcggctacagga
caacccattactacatatacttctcattatcgaaagcctagagagggtggggaacttcat
attattattgtagataacggacgtagtaagatattagccgacccaaagcatatcaagact
ttgaattgtattcgttgtggagcctgtatgaatacatgtcctgtatatagacgtagtggg
gggtactcttatacttattttattcccggccctatcgggattaacctggggatgttgaag
gcgccgttacattattatgacaatgtgtcggcttgttctttgtgttattcctgttcgttt
gtatgtccggctaaagtggatttggcggagcagatctatttgtggcgccaggatttggat
aaattgggtaaggcagaccggatgaaaaaggtaatgtccggtggcatggaattcatgatg
aagcgcccttcgatattcaatatggcattaaaatgggcgccattggtaaacggagtgccg
cgttttcttatctataacggattgaatgactgggggaaaggacgtgaaatgccgaaattt
gctaaggagagtttcaatgaaatgtggaagaaaggtaaagtgaagtaa

DBGET integrated database retrieval system