KEGG   Bacteroides vulgatus: BVU_2879Help
Entry
BVU_2879          CDS       T00546                                 

Definition
(GenBank) putative pyruvate formate-lyase 1 activating enzyme
  KO
K04069  
pyruvate formate lyase activating enzyme [EC:1.97.1.4]
Organism
bvu  Bacteroides vulgatus
Brite
Enzymes [BR:bvu01000]
 1. Oxidoreductases
  1.97  Other oxidoreductases
   1.97.1  Sole sub-subclass for oxidoreductases that do not belong in the other subclasses
    1.97.1.4  [formate-C-acetyltransferase]-activating enzyme
     BVU_2879
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3643819..3644547)
Genome map
AA seq 242 aa AA seqDB search
MIRVHSYESMGTFDGPGLRLVVFLQGCNFRCLYCANPDTIDTKGESTETAIDEIVRMAVS
QKAFFGKKGGVTFSGGEPTLQAKALIPLFQRLKEQNIHICIDTNGSIWNEEVEELLKWTD
LVLLDIKEFNNVRHRQLTERSNEQTIRTAEWLEKNGKPFWLRYVLVPGYSSFEEDIRALG
EHFKNYHMIQRVEILPYHTLGVHKYEAMGKEYKLNGIKENTLEQLETAKTLFGEYFNTVY
LN
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgatcagagtacattcttacgagtcaatggggacgtttgacggtcccggcttacgctta
gtcgtatttttacaaggatgcaatttccgatgtctctattgtgccaaccccgacacaatt
gacaccaaaggtgaaagtacggaaacggcaatagacgaaattgtgcgtatggctgtcagc
caaaaagcttttttcggtaaaaaaggaggtgtgactttcagcggcggcgaacctacattg
caagcaaaagcactgattccgttattccagcggttaaaagaacaaaacatccacatctgt
atagataccaacggcagtatatggaatgaggaagtagaggaactgctaaaatggacagac
ctcgtattattagatatcaaggaatttaataatgtgcgtcatcggcaactgacagaacgt
agcaacgaacaaaccatacgtaccgctgaatggcttgaaaaaaacggaaaacctttttgg
ttgcgctacgtattagttccaggctatagttcctttgaggaagacatacgggcattagga
gagcacttcaagaactatcacatgattcaaagagtagaaatactaccttatcatacatta
ggcgtacacaaatatgaagccatgggaaaagaatacaaactgaacggaataaaagaaaat
actttagaacaattggaaacagccaaaacgttatttggtgaatatttcaataccgtatat
ttaaattag

DBGET integrated database retrieval system