KEGG   Bacteroides vulgatus: BVU_2880Help
Entry
BVU_2880          CDS       T00546                                 

Definition
(GenBank) formate acetyltransferase
  KO
K00656  
formate C-acetyltransferase [EC:2.3.1.54]
Organism
bvu  Bacteroides vulgatus
Pathway
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bvu00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BVU_2880
   00640 Propanoate metabolism
    BVU_2880
   00650 Butanoate metabolism
    BVU_2880
Enzymes [BR:bvu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     BVU_2880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3644616..3646844)
Genome map
AA seq 742 aa AA seqDB search
MEMNKVFKDGLWSKEINVSDFVYTNITPYEGDASFLAGPTERTKKVWNECLKALEEERAN
NGVRSLDNVTVSTITSHKAGYIDRENELIVGLQTDELLRRAIKPYGGIKVVEKACHENGV
EVDEKVKDIFTHYRKTHNDGVFDAYTEEIRSFRSLGFLTGLPDNYARGRIIGDYRRLALY
GIDRLIEAKQEDLRNITSPMTDARIRLREEVAEQIKALKEIKILGEYYGLDLSRPATNAQ
EAVQWVYMAYLAAVKEQDGAAMSLGNVSSFLDIYIQYDLDHGKIDESFAQELVDQFIIKL
RMVRHLRMQSYNDIFAGDPTWVTESIGGRFNDGRTKVTKTSFRFLQTLYNLGPSPEPNMT
VLWSPELPEGFKEFCAQVSIDTSSIQYENDTLMREVRNCDDYGIACCVSYQAIGKQIQFF
GARCNLAKALLLAINGGRCENTGTVMVKDIPVLTGDLLNFEEVWSNYKKVLMQIARVYND
AMNIIHYMHDKYYYEKAQMAFIDTDPRINLAYGVAGLSIAIDSLSAIKYGKVRAKRNDIG
LTEGFDIENTYPCFGNDDDRVDHLGVDLVYFFSEELKKHPVYKNARPTLSLLTITSNVMY
GKKTGATPDGRAKGVAFAPGANPMHGRDKNGAIASLSSVAKLRYRDAQDGISNTFSIVPK
SLGVDRETRIENLITMMDGYFTKGAHHLNVNVLNREMLEDAMEHPEKYPQLTIRVSGYAV
NFIKLSREHQLEVISRSFHERM
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atggaaatgaacaaagtttttaaggatggattgtggagtaaggaaattaatgtttcagac
ttcgtatataccaacattaccccttatgagggcgatgcctcattcttggcaggccccaca
gagcgaactaaaaaagtgtggaacgaatgcctcaaggcactagaagaagaacgtgccaat
aacggagttcgttcccttgataatgtaacagtatctactatcacctcacataaagcagga
tacattgaccgtgaaaacgaactgattgtaggtcttcagacggacgaacttctgcgccgt
gccatcaaaccttacggtggtatcaaggtcgtagaaaaagcctgccatgaaaacggtgtg
gaagtagatgaaaaagtaaaggatatctttactcattatcgcaaaacccataatgatggc
gtatttgatgcttataccgaagaaatccgctctttccgttcactcggtttcctgaccggt
ctgcccgataactatgcacgcggacgcattattggtgactaccgccgtttggcactgtat
ggtatcgaccgactgattgaagcaaaacaagaagatttgcgcaatatcaccagtccgatg
accgatgcccgtatccgcctgcgcgaagaagtagccgaacaaattaaagcactgaaagaa
ataaaaatattgggtgaatattacggactcgatttgagccgtcccgctactaatgcacaa
gaagcggttcagtgggtttatatggcatatcttgctgccgtgaaagaacaagatggagca
gctatgtcattgggcaacgtttcttcattcctggatatctatattcaatatgatttggat
catggtaaaattgacgagtcattcgctcaggagctagtggatcagtttatcatcaagtta
cgtatggtccgccatctgcgtatgcaatcatacaatgacatctttgcaggtgaccccact
tgggtgaccgaatctatcggcggacgattcaacgacggacgcaccaaagtaacaaaaact
tctttccgcttcttacaaacactatacaatctgggtccgtcacctgaacccaatatgact
gtactgtggagtccggagttgccggaaggtttcaaagaattctgcgcacaggtttctatc
gacacttcttccatacagtacgaaaacgatacgctgatgcgcgaagtgcgtaactgtgac
gattatggcattgcctgctgtgtgtcttatcaggctatcggcaaacaaatccaattcttc
ggggcacgctgtaatctggctaaggctctgttactagctatcaatggcggacgttgcgaa
aatacaggaactgtaatggtgaaagatattcctgtattgacaggagacttgctgaacttt
gaagaagtatggtctaattataagaaagtattaatgcagattgcacgtgtgtataatgat
gcgatgaatatcattcactatatgcatgacaaatattattacgaaaaggctcaaatggca
ttcattgataccgatccacgtatcaatctggcatatggcgtagccggtctgtccattgcc
attgactcattgtctgccatcaaatacggcaaggtacgtgccaaacgtaatgatataggt
ttgactgaaggctttgatattgaaaatacatatccttgcttcggtaatgatgatgaccgc
gtagaccacttaggagtagatttggtttatttcttcagtgaagaattaaagaaacatccg
gtatacaaaaacgcccgtcctaccctgtcactgctgactatcacctccaatgtaatgtac
ggtaagaaaacaggtgccactcctgacggtcgtgccaaaggggttgctttcgctccgggt
gccaacccgatgcacggacgtgataagaacggtgccatcgcctcattgagttctgtagcc
aaactacgctatcgtgatgctcaggacggcatcagtaacacattctctatcgtaccaaaa
tcactaggagtggatcgggaaacccgcatagagaatctgataaccatgatggacggttat
ttcaccaaaggggcacaccacctgaatgtaaatgtgctgaaccgtgaaatgctggaagat
gcaatggagcatcctgaaaaatacccgcaacttactatccgcgtatcaggttatgccgta
aatttcatcaaattgagccgtgaacatcagctggaagtaatcagccgttctttccacgaa
agaatgtaa

DBGET integrated database retrieval system