KEGG   Bacteroides vulgatus: BVU_2882Help
Entry
BVU_2882          CDS       T00546                                 

Definition
(GenBank) transposase
Organism
bvu  Bacteroides vulgatus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3647626..3648360
Genome map
AA seq 244 aa AA seqDB search
MIAIIKGTDVHTVTSVLLKLSRRRRYQVREITLDMAPNMEQIARICFPAAKRVTDRFHVQ
KLAYEAVQEMRVKARWEALDEESTQIAYAKACGKMYHAPVFANGDTRKQLLARSIYLLYK
KESLWTQSQRIRAEILFKEYPDIKKGYYLSMRLGLIYHQCKFKDIALTRLARWYDEVDKS
GFLTFGRVARSIQTHYLDIINFFERRATNAEAESFNAKIKAFRAQFRGVRDRAFFLYRLA
KLYA
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgattgccatcattaaaggtacggacgttcatacggtcacttctgtcctgcttaagcta
tcccgtcgccgccgttaccaagtgcgcgagattactttggatatggctcctaacatggag
cagattgcacgcatctgctttcctgcggccaaacgtgttaccgatcgctttcacgtacag
aagttagcttatgaagcggtgcaggagatgcgggtaaaagctcgctgggaggctttggat
gaagagtccactcagattgcttatgcaaaggcctgtggaaagatgtatcatgcacctgtt
ttcgctaatggagatacaagaaagcagttgttagcgagaagtatttatctgctttacaag
aaggaatccttatggactcagtctcaaagaatacgggctgaaattcttttcaaggaatat
cccgatataaagaaaggatattatctgtctatgcggttaggcttaatctatcatcagtgt
aagtttaaggatattgctttgacaaggctggcaaggtggtatgatgaagtagataaatca
gggttcctcacctttggaagggtcgcacgttctatacaaacacattatctggatataatc
aatttttttgaaaggagggcaaccaatgccgaagctgagtcattcaatgctaaaatcaaa
gcatttagagcacagttcagaggagtaagagatagagcttttttcttatatagacttgct
aaattatatgcttaa

DBGET integrated database retrieval system