KEGG   Bacteroides vulgatus: BVU_2888Help
Entry
BVU_2888          CDS       T00546                                 

Definition
(GenBank) putative cell-cycle protein
  KO
K04075  
tRNA(Ile)-lysidine synthase [EC:6.3.4.19]
Organism
bvu  Bacteroides vulgatus
Brite
Enzymes [BR:bvu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.19  tRNAIle-lysidine synthase
     BVU_2888
Transfer RNA biogenesis [BR:bvu03016]
 Prokaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    BVU_2888
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3652698..3653951
Genome map
AA seq 417 aa AA seqDB search
MHDKVLVALSGGADSVALLRVLLVLGYHCEAAHCNFHLRGEESDRDERFVNELCKGLGVT
LHVTHFDTVTYASRHHVSIEMAAREMRYDWFEQLRKERGMAVIAVAHHRDDSVETFLLNL
IRGAGINGLKGISPHNGCIVRPLLEVSRQDILDYLRCLRQGYVTDSTNLQDEYMRNKIRL
NILPMLRELNPSVSESIAETSRRLTDVSLIYNKEIEAGKERVMEKSGHILISRLMEESAP
AALLFEILHPLGFNSVQVGDVFRSLSAQSGKRFVSAGWEVLRDRTELIIRRRKPADEEVE
ENVPPFRLAMETQEIMPDFVIPRNKNTACLDADKVVLPLTVRKWRQGDKFVPFGMKGKKK
VSDYLTDRKFSLFQKENQYVVCSADRIVWLVGERSDDRFRVTEDTKRVLIIRQLEDK
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
ttgcatgataaggtgttagtggcattgagtggcggagcagattcggtagctttgttgcgt
gtcttgcttgttttagggtatcattgtgaggctgcccattgtaacttccatcttcgtggt
gaggagtccgatagagatgaaaggtttgtcaatgagttgtgtaaagggctgggagtgact
ttgcatgttactcattttgatacagtcacttatgcttcaaggcatcatgtttctattgag
atggcagctcgcgaaatgcgctatgattggttcgaacaactgcgtaaggagagggggatg
gctgttattgccgtagcccatcatcgggacgatagtgtggaaacttttttattgaatttg
atacgtggcgcgggaatcaatggcttgaaaggtatcagtccgcataacggctgcattgta
cggcctttgttggaggtgagccgtcaggatattttggattatttgcgttgtttgcgtcaa
ggttatgttacagacagtaccaatctgcaagatgaatatatgcgtaataaaatccgtctg
aatattcttccgatgttgcgtgagctgaatccttctgtcagtgaaagtatagctgaaaca
tccagacgtctgactgatgtttctcttatatataataaggaaatagaggcggggaaagaa
agggtgatggaaaagtccggccatattcttatttctcgtttgatggaagagagtgctccg
gcggctttgctgtttgagattcttcatccgttaggtttcaattccgttcaggtaggagat
gtattccgcagtttgtctgcccagtcgggaaaaagattcgtttctgccggatgggaggtg
ctgcgcgacaggacggagctgattattcgcaggaggaagccggcggatgaggaagtggag
gaaaatgtgcccccattccggcttgcaatggaaacgcaggaaataatgccggactttgtc
atccccaggaataagaatacggcctgtttggatgcggataaggtggtgctacctctcacg
gtgcgtaaatggaggcagggggataagtttgttcctttcggaatgaaagggaaaaagaag
gtcagcgattatctgacagatcgtaagttttctcttttccagaaagaaaatcagtatgtg
gtttgctcagcagaccggattgtatggctggtaggagagcgtagcgatgaccgtttccgg
gtgacggaagatacgaaacgggtactgattatacggcagttggaagataagtag

DBGET integrated database retrieval system