KEGG   Bacteroides vulgatus: BVU_2891Help
Entry
BVU_2891          CDS       T00546                                 

Definition
(GenBank) DNA repair protein recN
  KO
K03631  
DNA repair protein RecN (Recombination protein N)
Organism
bvu  Bacteroides vulgatus
Brite
DNA repair and recombination proteins [BR:bvu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     BVU_2891
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    BVU_2891
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3656645..3658306)
Genome map
AA seq 553 aa AA seqDB search
MLQSIYIQNYALIDTLDISFTPGFSVITGETGAGKSIILGAIGLLLGQRADIKAIKKGAN
KCIVEARFNISAYQMEPFFTQRDLEYDPDECIIRRELYASGKSRAFINDTPASLAQMKEL
GEKLIDVHSQHQNLLLNSEGFQLNVLDILAQDDNELSAYKDIYTEYRNVCKQLADFITQA
EQSRKDEDYIRFQLEQLDDANLQEGEQTELEQEAETLNHAEEIKAGLYKVDQIMASEDAS
LLSATKECMQTLHNIARVYTRAQEWIGRLDSCYIELKDLSHEIAGAQEEVEFNPTRLDYV
NERLNLIYSLQQKHHVQTIEELIAVQTDYHEKLNAITSFDDRIAELTAQKETLYDKVIKQ
AAVLTKLRSQSGKHIERQMQSLLVPLGMPNVRFVVELNPRKEPDSKGMDSVTFLFSANKN
GTLQNVASVASGGEIARVMLSLKAMIAGAVKLPTIIFDEIDTGVSGSIAEKMALIMQEMG
KQNRQVISITHLPQIAARGITHYKVYKEDTETGTNSHIRRLTDEERVKEIANMLSGATLT
EAALNNAKALISG
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgctgcaatctatctatatacagaattatgcattgattgatacattggatatcagtttc
acccccggcttctctgtcatcaccggagagaccggtgccggtaaatcgattattctaggc
gctatcggcttgttactgggacaacgggccgatatcaaagcgatcaagaaaggcgccaat
aaatgtattgtagaagcacgtttcaacatctccgcctatcagatggagcctttctttacc
caaagagatttggaatatgatccggatgaatgtattatccgccgcgagttatatgcatca
ggtaaaagccgcgcattcataaacgatactccggcctcattggcgcagatgaaggaactg
ggcgagaaactgatagatgtacatagccagcatcaaaacctgttgctcaacagtgaggga
ttccaattgaatgtattggatatcctggcacaggatgacaacgaactttcagcatacaag
gatatttataccgagtacaggaacgtatgcaaacagctggccgacttcataacgcaagcc
gagcaaagccggaaggatgaagattacatccggttccaactggaacagctggatgatgca
aaccttcaggaaggagaacaaaccgaactggaacaggaagccgaaaccttgaatcatgcc
gaagagataaaagcgggcttgtacaaagtggaccaaataatggcttcggaagatgccagc
ctgttgtccgctaccaaagaatgtatgcaaaccctgcataacatagcgagagtgtacaca
cgtgcccaggaatggatagggcgtttagacagttgttacatagaactgaaagatctgtcg
catgaaatagcaggcgcacaggaggaagtggagttcaaccccacccgtctggattatgta
aatgaacgcctgaacttaatctactctttgcaacagaagcatcacgtacaaacaatagag
gaattgatagccgtgcaaaccgactatcatgagaagctgaacgccatcacttcttttgat
gaccgtatagcagaacttaccgcccaaaaagaaacgctatatgacaaagtgataaagcaa
gctgctgtgttgacaaaactccgttcccaatcgggcaagcacattgaaagacagatgcaa
agcctgctggttcctctcggtatgcccaatgtgcgctttgtggtggaactgaatccgcgc
aaggaaccggacagtaaagggatggacagtgtgacattcctgttttcggccaacaagaat
ggaacattacaaaatgtagcttccgtagcatcgggtggtgagattgcccgtgtcatgctt
tcgctgaaagccatgatagccggagctgtgaaactgcctactatcatctttgatgaaata
gacaccggagtttccggttccatcgccgagaaaatggcgctcatcatgcaggagatggga
aaacaaaaccgtcaggtcatcagcatcacccacctgccccagattgcagcacgcggcatc
actcattataaagtatataaggaagatacggaaacaggcaccaacagccacatccgccgc
ctgactgatgaagaaagagtaaaagaaattgccaatatgctaagtggggctaccttgaca
gaggcagccctgaacaatgcaaaggcgctgataagtggctag

DBGET integrated database retrieval system