KEGG   Bacteroides vulgatus: BVU_2893Help
Entry
BVU_2893          CDS       T00546                                 

Definition
(GenBank) DNA Pol III epsilon chain
  KO
K02342  
DNA polymerase III subunit epsilon [EC:2.7.7.7]
Organism
bvu  Bacteroides vulgatus
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:bvu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BVU_2893
   00240 Pyrimidine metabolism
    BVU_2893
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    BVU_2893
   03430 Mismatch repair
    BVU_2893
   03440 Homologous recombination
    BVU_2893
Enzymes [BR:bvu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     BVU_2893
DNA replication proteins [BR:bvu03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     BVU_2893
DNA repair and recombination proteins [BR:bvu03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     BVU_2893
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3659631..3660407)
Genome map
AA seq 258 aa AA seqDB search
MKLNLKNPIVFFDLETTGTNINTDRIVEICYLKVYPNGNEETKTMRINPEMHIPEQSSAI
HGIYDADVADCPTFKEVAKEIARDIEGCDLAGFNSNRFDIPVLAEEFLRAGVDIDMMKRK
FIDVQVIYHKLEQRTLSAAYKFYCGKNLEDAHTAEADTRATYEVLKSQLDRYPEELQNDM
AFLAEYSSFNKNVDFAGRIVYDDKGVEVFNFGKYKGMSVSEVLQKDPGYYSWILNGDFTL
NTKNVLTKIRLRESGMMK
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgaacttgaagaatcctattgtttttttcgatttggaaacaacgggaacaaat
ataaacacagacagaatagtggaaatatgctatctgaaggtgtacccaaacggcaacgaa
gaaacgaagaccatgcgtatcaatccggaaatgcatattcccgaacaatcttctgccatc
cacggtatttatgacgcagatgtggcggactgccctactttcaaggaagtggcaaaagag
atagcccgggacattgagggatgtgaccttgccggtttcaattccaatcgtttcgacatt
ccggttctggccgaggagttcctgcgcgcaggagtagacattgacatgatgaaacgaaaa
ttcattgacgtgcaggtgatttatcacaaactggaacagcgcaccctgtctgccgcctat
aaattctattgcggaaagaatctggaagatgcccatacagccgaagccgacacacgtgcc
acatacgaagtactgaaatcccaattggaccgctatccggaagaattgcaaaacgatatg
gcatttctagccgaatattcaagtttcaacaagaacgtagatttcgccggacgcattgtt
tatgatgacaaaggcgtggaagtctttaattttgggaaatacaaaggaatgtcggtcagc
gaagtattacaaaaagatccgggctactacagctggatactgaacggtgactttacgctg
aacacgaaaaacgtactgacaaaaatcagactacgtgaatcgggaatgatgaaatga

DBGET integrated database retrieval system