KEGG   Bacteroides vulgatus: BVU_2896Help
Entry
BVU_2896          CDS       T00546                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bvu  Bacteroides vulgatus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4270
Motif
Other DBs
NCBI-ProteinID: ABR40535
UniProt: A6L4C1
Position
complement(3662364..3663794)
Genome map
AA seq 476 aa AA seqDB search
MKIKYLCALLLAALIYSCDDSTTGIGTDLIPGGDKIPANTDSYEFTTKSLLADSVYARTS
TAYLGRYTDEQFGEFTADFIAQFTCMDNFKFEEELTKVIGVNISLQYGSFFGDSLNAMRL
QVDTLDKVIPEKELSTFYTSVDPKDYYNEKGKPIAVKAYSAVGPSTSKDETTTTSSGVKQ
RTIIQTIKLPNSLGDHIFNKYKENKEYFKTPESFIKNVLKGVYIRCTHGDGTILYIDGLS
LNLNFEALIESSSGKRDSLVYKSYFFGATKEVIQANHFSNGSRLEELAQDPDHTYLKSPA
GIFTEATFPIAEIYNEHKRDTLNGVNVSFTRYNEKESKYKMGIPQYVLMVRKKDMFSFFE
ENKIIDNKTSFLSSYSSSNNTYTFTNIAPLITYCIEERKKGITAAGGDPEKEEDGKKWDA
ENPDWNRVVIIPVKAVSNSNNEIVEISNSLGMESAMLKGGTNPENKLKMQIFYTTF
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcaaatacttatgcgcattgttgttggctgcacttatttatagttgcgatgat
tcaacaaccggcatcgggactgatcttatccccggtggagataagattccggcaaataca
gacagttatgagtttaccaccaaatctctgttggccgactctgtttatgcacgtaccagt
actgcatatttaggacgatataccgatgagcaatttggagaatttactgccgactttata
gcacagttcacctgtatggacaacttcaaatttgaagaagagctgaccaaagtcatcgga
gtaaatataagtctgcaatacgggtctttctttggtgactcactgaatgccatgcgctta
caggttgacacattggacaaggttattcctgaaaaagaactaagtactttctataccagt
gtggatcctaaagattattacaacgaaaaaggaaagcctatcgctgtaaaagcctattcg
gcagtaggtccgtctacaagcaaagatgaaactacaaccacaagcagcggtgtcaagcaa
agaacaattatacagactatcaaattgcccaattcattaggcgatcacatcttcaacaaa
tacaaggagaacaaagagtatttcaagactcctgaaagttttatcaagaatgtattaaag
ggagtttacattcgctgtactcatggcgacggaaccattttatacattgacggtttaagc
ctgaatcttaattttgaagccctgatagaaagttcttccggcaagcgggattcgttggtt
tacaagtcctatttctttggagcaaccaaggaagtgatacaagccaaccacttcagtaac
ggtagcagattggaagagttagcccaagatccggaccatacttacctcaaaagtccggca
ggtatttttacagaagcgactttccccattgcagagatttacaatgaacataaaagagat
acgctaaatggtgtaaatgtatcgttcacacgctacaacgagaaagagtccaaatacaaa
atgggcatcccccaatatgtattgatggtcagaaagaaagatatgttctcgttctttgaa
gaaaacaagattatcgacaacaagacttctttcttaagttcatatagcagcagtaacaat
acatacacctttaccaacatcgctcccttaatcacttactgtattgaggaacggaaaaaa
ggcataacagcagcaggtggagatcctgaaaaggaagaagacggaaaaaaatgggacgct
gaaaatccggactggaacagagttgtcatcatacctgtcaaagcagtatccaattcaaac
aatgaaatagttgaaatatccaacagcttaggtatggaaagcgctatgttaaaaggtgga
acgaatcctgagaataagctgaaaatgcaaatcttctacactacattttaa

DBGET integrated database retrieval system