KEGG   Bacteroides vulgatus: BVU_2899Help
Entry
BVU_2899          CDS       T00546                                 

Definition
(GenBank) aspartate 1-decarboxylase precursor
  KO
K01579  
aspartate 1-decarboxylase [EC:4.1.1.11]
Organism
bvu  Bacteroides vulgatus
Pathway
beta-Alanine metabolism
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Pantothenate biosynthesis, valine/L-aspartate => pantothenate
Brite
KEGG Orthology (KO) [BR:bvu00001]
 Metabolism
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BVU_2899
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    BVU_2899
Enzymes [BR:bvu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.11  aspartate 1-decarboxylase
     BVU_2899
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3665860..3666210
Genome map
AA seq 116 aa AA seqDB search
MMIEVLKSKLHCVRVTEANLNYMGSITIDEDLMDAANMIAGEKVHIVDNNNGERFETYII
KGERGSGCICLNGAAARKVQVGDIVIIMSYAMMDFEEAKSFKPTVVFPDSAMNKIV
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atgatgattgaggtattaaagtcgaaactgcattgtgtccgtgtaacggaagccaatttg
aattacatgggtagtattacgattgacgaggacttgatggatgccgccaacatgattgcc
ggcgagaaagtgcacattgtggataataataacggcgagaggtttgaaacttatattatt
aagggtgagcgcggttcgggatgtatttgtctgaatggggctgctgcccggaaagtacag
gtgggtgacattgtgattatcatgtcatacgccatgatggattttgaggaagctaaatcg
ttcaagccgacggtggttttccctgattcggcgatgaacaagattgtataa

DBGET integrated database retrieval system