KEGG   Bacteroides vulgatus: BVU_2910Help
Entry
BVU_2910          CDS       T00546                                 

Definition
glycoside hydrolase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
bvu  Bacteroides vulgatus
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bvu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BVU_2910
  Lipid metabolism
   00600 Sphingolipid metabolism
    BVU_2910
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BVU_2910
Enzymes [BR:bvu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     BVU_2910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3679647..3682271
Genome map
AA seq 874 aa AA seqDB search
MKKLFILLVCLLPVLAQAQMETSVAGFIPLSGSGRIVYNFNPGWRFHRGDIKGAEAVRFD
DTSWQVVSVPHTVELMPAEASGCRNYQGVAWYRKHFVIPQDMKGKEVSLHFEGAMGKQVI
YLNGKRVQEHLGGYLPFTVQLTEQGVQPGDSCLLAVMTDNSDDKNFPPGKRQYTLDFAYH
GGIYRDVWMIGKSSVAITDALEADKVAGGGVFVHFDNISGKKAEVYVDTEVHNSGKQTRT
VAVETVLADAGDVPVKRVSQQVKLQAGESKTVRQRFAVRNPKLWSPDSPYLYRIQSRVKA
GHEVLDGGVTRVGIRKAEFKGKDGFWLNGKPFGQLVGANRHQDFAYVGNALPNSQQWRDA
KRLRDAGCTIIRVAHYPQDPAFMDACDEMGLFVIVATPGWQYWNKNPEFAKLVHRNTREM
IRRDRNHPSVLMWEPILNETPYPRDFALEALRITREEFPYPGRPVAAADVHSKGVAENYD
VVYGWPGDDEKADRPEQCIFTREFGENVDDWYAHNNNNRASRSWGERPLLVQALSLSKSY
DEMYRTTGQFVGGAQWHPFDHQRGYHPDPYFGGIYDAFRQPKYAYYAFRSQSAATLKHPV
AECGPMVFIAHEMSPFSDADVVVFSNCDSVRLSVYDGTESRTLPVVHAQGHMPNAPVIFK
DVWDFWEAREYSYKQKNWQKVNMVAEGIIDGKVVCTYKRMPSRRSTKLRMYVDTEGKQLV
ADGSDFIVVVAEVTDDSGNVRRLAKENIVFTVEGEGRIIGDASINANPRTVEFGSAPVLI
RSTRKPGKIKVKAHVQFEGTNAPVATEIELESIPSELPFCYTEEETDAQSAGAGLAGSPV
RTERMAGKVVLTEEERQKVLMEVERQQTEFGTEK
NT seq 2625 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaactgtttattttacttgtgtgcctgttgcctgtgttggcacaagctcaaatg
gaaacctctgtagccggattcatccctttatccggtagcggaagaatagtatataatttc
aatcccggatggcgctttcatcgtggagacataaaaggcgcggaagccgtacgttttgat
gatacatcctggcaggtagtgtctgttccgcatactgtggaactgatgcctgccgaggca
agcggttgccgtaactatcagggtgtggcatggtaccggaaacattttgtgattcctcaa
gatatgaaaggaaaagaggtgtcgcttcattttgagggagctatgggaaaacaggtgatt
tatttaaatggcaagagggtgcaagagcacttgggaggataccttcctttcactgtgcaa
ctgacggaacagggggtacagcccggagacagttgcttgctggcagtgatgacggataat
agtgatgataagaattttcctccgggaaaacgtcaatataccttggatttcgcttatcat
ggaggaatttaccgggatgtgtggatgataggaaaatcaagtgtagctattacagatgcc
ttggaggccgataaggtggccggaggtggagtttttgtgcattttgacaatataagcggg
aaaaaagcggaagtgtatgtggatacggaagtgcataacagtggaaagcagacgcgtacc
gtagccgtggagacggttttggcggatgccggcgatgttcccgtaaaacgggtttcgcaa
caggtgaagctgcaagcaggggaatcgaagacggtgcggcaacggtttgcagttcgcaat
cctaagttatggtctcctgactcgccttatttgtataggatacaatctcgtgtcaaagcc
ggacatgaagtgttggatgggggagtgacacgtgtggggatccgcaaagcggaatttaaa
ggtaaggatggcttttggttgaatggcaagccttttggtcaattggtcggcgcgaaccgt
catcaggattttgcatacgtgggtaatgcgctgcccaacagccagcaatggagggatgcc
aaacgcttgcgtgatgcaggatgtaccattatccgtgtagctcattatccgcaagatccg
gcattcatggatgcttgcgacgaaatggggctgtttgttattgtggctactccgggatgg
caatattggaataaaaatccggagttcgcaaagctggtacatcggaatacccgtgagatg
atacgccgggaccgcaatcatcccagtgtgctgatgtgggagcctattttgaatgaaacg
ccttatccgcgcgatttcgcactggaggcgttacggattacacgggaggagtttccttat
cccggacgtcctgtagcggcagccgatgttcattcgaaaggagtggcggaaaactatgat
gtggtgtacggatggccgggagatgatgagaaggcagaccgtccggaacaatgtattttt
actcgtgagtttggcgagaatgtggatgactggtatgcacataataataataaccgtgcc
agccgtagctggggggaacgcccgttgctggtgcaggcgttgtcattatcaaagagttat
gatgaaatgtaccgcactacagggcagtttgtcggtggggcgcaatggcatccttttgac
catcagcgggggtatcatcccgatccgtatttcgggggcatttatgatgcgttccgtcag
cctaaatacgcttattatgcttttcgcagccagtctgccgcgacattgaagcatcctgtg
gcggaatgtgggcctatggtgtttatcgcccatgagatgtctcctttctcggatgccgat
gtggtggtgttcagtaattgtgactcggttcgtctctctgtctatgacggtactgagagc
cggacgcttccggttgttcatgcgcagggacacatgcctaatgccccggtgatattcaag
gatgtatgggatttctgggaagcacgcgagtatagttataagcaaaaaaactggcagaaa
gtaaatatggtggcagaaggaattatagacggtaaagtggtttgcacctataagcggatg
ccgtcacgccgcagcacgaagttgcgtatgtatgtggatacggaaggaaagcaattggtg
gcagacggttcggattttatcgtagtggtggccgaagtgacggatgatagcggtaatgtg
cgccgtctggcaaaagaaaatatcgtatttactgtagaaggtgaaggacgaattataggg
gatgcctctatcaatgccaatccgcgcacggtggagtttggctctgctcccgtattgatc
cgttctacccgcaagcccggcaaaataaaggtgaaggcccatgtgcagtttgaaggaacg
aatgcaccggttgctacggaaatagaattagaaagtattccgtcagaactgcctttctgt
tatacggaggaggagacggatgcccaatcagccggagcaggactggccggaagccctgtt
agaacagaaagaatggcggggaaagttgtgctgacagaagaggaaaggcaaaaagtattg
atggaggtggagagacagcaaactgaattcggtacggagaagtaa

DBGET integrated database retrieval system