KEGG   Bacteroides vulgatus: BVU_2913Help
Entry
BVU_2913          CDS       T00546                                 

Definition
(GenBank) putative outer membrane protein, probably involved in nutrient binding
Organism
bvu  Bacteroides vulgatus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3687880..3691335
Genome map
AA seq 1151 aa AA seqDB search
MKKENAFLQKLDKIGNLTQVVCLSLFLTGVSVQGVSAETGFPISQSVQQTKTVTGQVVDE
TGEPVIGASVMVEGTTNGTITDFDGRFALQVPSGKKVVISFVGYVPQTIAPKQGKDFRVV
LKEDSKMLDEVVVVGYGTQKAKDVTGSIGVITPSEISDLPVSNLGAALAGQIPGLSISGG
DSRPGEGATMSIRQSFSYSKDGGSTNPMVIIDDVIQIDANSGLPTLETFNALDPSEIESI
SVLRDASAAIYGSRASQGAIIVKTKRGKSGAPKINYSGKFGFNDAVGHPKTLKGAAYGRF
ANSFNLANNKISMDPDGNWMNKIYNEAELAEMDGLNYNWLDEAWSGAFTMNHSVNVSGGS
EKATYFAGASYYTQGANLGKQDYNRWNFRAGVDIKLTSDLKFSATIAGNQQETTSSFTKG
LSNLNGYGGTKPGESGDYLVLAHMPNYLPWEITLDDGNTYYTSPLLNSYSSAGNATSGNK
MSTWNYFAMENNDGSYSTNDNFSYDANFSVTYAVPFIKGLSFKGSYALKRSASDSEQAFM
PFTLAYLKASDALTPGNRFYSDHPSVSDYQLKEFTGSTRVVYSDQMAKNEQLNFYVNYEG
KFGKHSIAAMAAVEKMQAYMHSKRMLFNNPDPDGYLGTSPSAGAMDTGNSITYKYKQGSL
SYLGRVSYNYADKYLFQFLFRSDASTKFAPANYWGFFPGVSVGWVASEEEFMKKLLPSWF
EYMKVRFSWGRTGKDNIKAWGWKQLYSLDPSRGYGFGSNGGILQTGIKPGATPNPDAHWD
NTDKFNLGFDLRFLNNRLSATVDVYYDINSDILNQNIGGIIGTPIFAGGALTEVNFGRID
AFGSEFSLNWRDKIDQVKYNIGVNFGFNGNRVREWPQSAPSYIQENSVREGASTIFPTYG
YKVWRGTSSGDGILRNSDDIENYWNYLSANAEAAGTSPEYLGVKDASQLKPGMLAYQDLG
GVLNEDGTQSGPDGRIAKTQDYAKLNKSGKTYGFTTKLGAEWKGISFNMMIATSWGGYRQ
IDVNKITTSSGDMLWTPDSFWEDMFDERNNTTGKYPNLGLDNRISGSVIAPSDFWSISTF
RCYIRNLSIGYTLPKAWLSPLKIQSAKLSLTGNNLWDFYNPYPDHYRNMYCGTTSLYPTL
RTWSLGVNVSF
NT seq 3456 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaagaaaatgcatttcttcagaagctggacaagattggcaacttgacacaagtg
gtctgtctcagtctgtttctgacaggagtttctgttcagggagtatccgctgagacagga
tttcctatatcccagtcggtgcaacagactaaaactgtcaccggacaggtggttgatgaa
actggtgaaccggtgattggtgccagtgtgatggtggaaggaactacaaacggtaccatt
actgattttgacggaagatttgctttgcaagtcccttcgggcaagaaggttgtcatttca
tttgtggggtatgtgccgcaaacgattgctccgaaacaaggaaaagactttagagtggtg
ctgaaggaagattccaaaatgctggacgaagtggttgtagtcggttacggtactcagaaa
gcaaaagatgtgacaggatctatcggggttattactccttcggaaatttcagatttgccg
gtgtcgaatttgggtgctgcgctagcgggacagatacctggtttgagtatcagtggtggt
gacagccgtccgggtgaaggggcaactatgtctattcgtcaatctttctcgtattctaaa
gatggtggtagtactaatccgatggtcataatcgatgatgtgattcagatagatgccaac
agcggtcttccgacattagaaactttcaatgcccttgatccttctgaaattgaaagtatt
tcagtccttcgtgatgccagtgctgccatttacggttcccgtgcttcgcaaggtgctatt
attgtaaagaccaaacgaggtaaatcaggagctcccaaaatcaattattcaggtaaattc
ggatttaatgatgcagtgggacatcctaaaaccttaaaaggagcagcttatggacgtttt
gccaattcctttaatttggccaataataagataagtatggatccggatggaaactggatg
aataaaatttataatgaagcggaactggccgagatggatggcttgaattacaattggctg
gatgaagcctggtccggcgcttttacaatgaaccattcggtcaatgtaagtggcggtagc
gagaaagctacttattttgcgggtgcttcttactatactcagggggcgaatcttggaaaa
caggattataatagatggaacttccgtgcaggtgtggatatcaaattgacttccgatttg
aaattttctgcaaccatagcgggtaaccagcaggaaaccacatcgagttttaccaaaggt
ttaagcaatttgaacggttatgggggaactaagcccggtgaatccggtgattatttggtt
cttgctcatatgccgaattatttgccatgggagataacattggatgatggtaatacctat
tatacatctcctttgttgaatagttactcgagtgcgggtaatgcaacatcgggcaataaa
atgagtacatggaattattttgctatggagaataatgacggttcttattccacgaatgat
aatttcagttatgatgccaacttctccgtcacttatgccgttccgtttatcaaaggtctt
tcattcaagggaagctatgcgttgaagcgtagtgccagtgatagtgagcaggcatttatg
ccatttacgttggcttatctgaaagcaagcgatgcattgacacccggaaatcgtttttat
agcgatcatccgtctgtttccgattatcaattaaaagaatttacgggaagcactcgtgtg
gtatattcagaccagatggctaaaaacgagcaattgaacttctatgtgaattatgaagga
aagtttggcaagcatagcattgccgccatggctgcagtggaaaaaatgcaggcttatatg
cattccaagcggatgttgtttaataaccctgacccggatggttatttgggtacttcgcca
agtgcgggagcgatggatacaggtaattctattacatataaatacaaacagggttctttg
tcttatttaggtcgtgtaagctataattatgccgataagtatttgttccaattcctattc
cgtagcgatgcttccactaaatttgctccggccaattattggggcttcttcccgggtgtt
tccgtggggtgggtagcttcggaagaagaatttatgaagaagttgctgccgtcatggttt
gaatacatgaaagtacgtttctcatggggacgtaccggtaaagataatatcaaagcatgg
ggatggaagcaactctattcattggatcctagtagaggatatggattcggttctaacggt
ggtatcctgcaaacgggtatcaagccgggagcgactcctaatcctgatgcgcattgggat
aataccgataaatttaatcttggttttgatttgcgtttcctcaataaccgtttaagtgcg
actgtggatgtgtactatgatataaactctgacatcttgaatcagaatatcggtggtatc
ataggtactcctatttttgcaggaggtgctttgacagaagtgaactttgggcgtattgat
gcttttggtagtgaattctctttgaattggcgcgataaaatagatcaggtgaaatataat
atcggagtgaattttggatttaatggcaacagggtaagagaatggccccagtctgctccg
agttatatacaggaaaattctgtaagagagggtgcttctactatattccctacatacggg
tataaagtatggagaggtacaagttccggagatggtattttacggaacagtgatgatatt
gagaattattggaactatttatcggccaatgcagaagccgcaggcacttctccggaatat
ttgggcgtaaaagatgccagtcagttaaaaccgggtatgttggcttatcaggatttgggt
ggcgtattgaatgaggatggtacgcagtcggggcccgacggacgtattgccaagacccag
gattatgccaaactgaataagagtggaaagacatatggttttaccaccaaactgggggcg
gaatggaaaggtatcagctttaatatgatgattgccacttcatggggtggttatcgccag
attgacgtcaataaaatcacaacatccagtggggatatgctttggacaccggactcattc
tgggaagatatgtttgatgaaagaaataatacgacggggaaatatcctaatttaggttta
gacaacagaatatcaggatcagtaattgcaccgtctgatttttggtctatcagtacgttc
cgttgctatatccgtaacttaagtatcggttatacgctgcctaaggcatggttgtcacct
ttaaagatccagtcggctaaattaagtctgacaggtaataatctatgggatttctataac
ccgtatcccgatcattatcgtaatatgtattgtggaacaacttcattgtatcctacattg
agaacgtggtcgttgggagtaaatgtatcattctaa

DBGET integrated database retrieval system