KEGG   Bacteroides vulgatus: BVU_2971Help
Entry
BVU_2971          CDS       T00546                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
bvu  Bacteroides vulgatus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bvu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BVU_2971 (recR)
DNA repair and recombination proteins [BR:bvu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      BVU_2971 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3768285..3768902
Genome map
AA seq 205 aa AA seqDB search
MNQQYPSMLLEKAVGEFAKLPGVGRKTAMRLVLHLLRQDTAVVEAFGNAMITLKHEVKYC
KVCHNISDTETCRICSNPARDASTICVVESIRDVMAVEATQQYRGLYHVLGGVISPMDGI
GPSDLQIESLVERVKGGEVKEVILALSSTMEGDTTNFYISRKLDGMDVKLSVIARGISIG
DELEYTDEVTLGRSIINRTLFTGTA
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaacaatatccgtccatgctgctggaaaaagcggtaggagagtttgccaagttg
ccgggtgtgggacgcaagaccgccatgcggctggtattgcatctgctcagacaggatacg
gctgtggtagaggcgtttggtaatgcgatgattaccttgaaacatgaagtgaaatattgt
aaagtgtgccataatatatcggacacggaaacttgccgtatctgttccaatccggcacgg
gacgcttccacgatctgtgtggtggagagtatccgtgatgtgatggcggtggaagccacg
cagcagtacagggggctgtaccatgtcctggggggagtcatctcgcccatggatggcata
ggcccttccgatctgcagatagaaagtctggtggaacgggtgaaaggcggtgaggtgaag
gaagtgatccttgccttgagctcgacgatggagggggacacgacgaatttctatatctcg
cgcaagctggacggcatggacgtgaagctgagtgtgatagcgcgtggtatctctatcggg
gatgagctggaatatacggatgaagtgacgttgggacgttccatcataaatcgtactttg
tttacgggaacggcataa

DBGET integrated database retrieval system