KEGG   Bacteroides vulgatus: BVU_3055Help
Entry
BVU_3055          CDS       T00546                                 

Definition
2-dehydro-3-deoxygluconokinase
Orthology
K00874  
2-dehydro-3-deoxygluconokinase [EC:2.7.1.45]
Organism
bvu  Bacteroides vulgatus
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
D-Galacturonate degradation (bacteria), D-galacturonate => pyruvate + D-glyceraldehyde 3P
Class
Metabolism; Overview; Carbon metabolism [PATH:bvu01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:bvu00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3866130..3867152
Genome map
AA seq 340 aa AA seqDB search
MGKVVTLGEIMLRLSTPGNTRFVQSDSFDVVYGGGEANVAVSCANYGHEAYFVTKLPKHE
IGQSAVNALRKYGVKTDFICRGGDRVGIYYLETGASMRPSKVIYDRAHSAIAEADPCDFD
FDAIMEGADWFHWSGITPAISDKAAELTKLACEAAKRHGVTVSVDLNFRKKLWTKEKAQS
IMKPLMQYVDVCIGNEEDAELCLGFKPEANVEAGETNAEGYKGIFKAMAKEFGFKYVVST
LRESFSATHNGWKAMIYNGEEFYESKRYDINPIIDRVGGGDSFSGGIIHGLLTKPNQGAA
LEFAVAASALKHTINGDFNLVSVDEVEALAGGDASGRVQR
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaagtagtaaccttaggtgaaattatgttgagattgtcaactccgggaaataca
cgttttgtacagtcggattcatttgatgttgtttatggcggtggtgaagcgaacgtagcg
gtgagttgcgcgaactacggtcacgaagcttatttcgtaactaaattgccgaaacacgaa
attggacagtctgctgtgaatgcattgcgtaaatatggtgtgaagaccgatttcatctgt
cgtggtggcgaccgcgtaggtatctattatctggaaacaggagcttccatgcgtcctagc
aaagtaatttatgaccgtgcccactcggctatcgccgaagccgatccttgcgatttcgac
tttgacgctatcatggaaggtgcggactggttccactggtcgggtatcactccggctatt
tctgacaaggctgccgaactgaccaaactggcttgtgaagctgcaaaacgtcatggcgtt
acggtatctgtagacttgaatttccgcaagaaactgtggacaaaagaaaaagcacagtct
atcatgaaaccgttgatgcagtatgtagatgtatgtataggtaacgaagaagatgccgaa
ctttgtctgggcttcaaaccggaagcgaatgtggaagccggtgaaaccaatgcggaaggt
tacaaaggaatcttcaaggctatggcaaaagaattcggctttaaatatgtggtttctacc
ttgcgcgaatcattctcggctactcacaacggctggaaggctatgatttataacggagaa
gaattttatgaatcaaaacgctatgacatcaacccgattattgaccgggtaggtggtggc
gactcattctccggaggtatcattcacggtctgctgaccaaaccgaatcagggtgccgcc
cttgaatttgctgttgccgcttctgctttgaagcatactatcaacggtgacttcaacctg
gtatctgtagatgaagtggaagcattggccggtggcgatgccagcggacgtgtacaacgc
taa

DBGET integrated database retrieval system