KEGG   Bacteroides vulgatus: BVU_3055Help
Entry
BVU_3055          CDS       T00546                                 

Definition
2-dehydro-3-deoxygluconokinase
Orthology
K00874  
2-dehydro-3-deoxygluconokinase [EC:2.7.1.45]
Organism
bvu  Bacteroides vulgatus
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
D-Galacturonate degradation (bacteria), D-galacturonate => pyruvate + D-glyceraldehyde 3P
Brite
KEGG Orthology (KO) [BR:bvu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BVU_3055
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BVU_3055
Enzymes [BR:bvu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.45  2-dehydro-3-deoxygluconokinase
     BVU_3055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3866130..3867152
Genome map
AA seq 340 aa AA seqDB search
MGKVVTLGEIMLRLSTPGNTRFVQSDSFDVVYGGGEANVAVSCANYGHEAYFVTKLPKHE
IGQSAVNALRKYGVKTDFICRGGDRVGIYYLETGASMRPSKVIYDRAHSAIAEADPCDFD
FDAIMEGADWFHWSGITPAISDKAAELTKLACEAAKRHGVTVSVDLNFRKKLWTKEKAQS
IMKPLMQYVDVCIGNEEDAELCLGFKPEANVEAGETNAEGYKGIFKAMAKEFGFKYVVST
LRESFSATHNGWKAMIYNGEEFYESKRYDINPIIDRVGGGDSFSGGIIHGLLTKPNQGAA
LEFAVAASALKHTINGDFNLVSVDEVEALAGGDASGRVQR
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaagtagtaaccttaggtgaaattatgttgagattgtcaactccgggaaataca
cgttttgtacagtcggattcatttgatgttgtttatggcggtggtgaagcgaacgtagcg
gtgagttgcgcgaactacggtcacgaagcttatttcgtaactaaattgccgaaacacgaa
attggacagtctgctgtgaatgcattgcgtaaatatggtgtgaagaccgatttcatctgt
cgtggtggcgaccgcgtaggtatctattatctggaaacaggagcttccatgcgtcctagc
aaagtaatttatgaccgtgcccactcggctatcgccgaagccgatccttgcgatttcgac
tttgacgctatcatggaaggtgcggactggttccactggtcgggtatcactccggctatt
tctgacaaggctgccgaactgaccaaactggcttgtgaagctgcaaaacgtcatggcgtt
acggtatctgtagacttgaatttccgcaagaaactgtggacaaaagaaaaagcacagtct
atcatgaaaccgttgatgcagtatgtagatgtatgtataggtaacgaagaagatgccgaa
ctttgtctgggcttcaaaccggaagcgaatgtggaagccggtgaaaccaatgcggaaggt
tacaaaggaatcttcaaggctatggcaaaagaattcggctttaaatatgtggtttctacc
ttgcgcgaatcattctcggctactcacaacggctggaaggctatgatttataacggagaa
gaattttatgaatcaaaacgctatgacatcaacccgattattgaccgggtaggtggtggc
gactcattctccggaggtatcattcacggtctgctgaccaaaccgaatcagggtgccgcc
cttgaatttgctgttgccgcttctgctttgaagcatactatcaacggtgacttcaacctg
gtatctgtagatgaagtggaagcattggccggtggcgatgccagcggacgtgtacaacgc
taa

DBGET integrated database retrieval system