KEGG   Bacteroides vulgatus: BVU_3322Help
Entry
BVU_3322          CDS       T00546                                 

Definition
1,4-alpha-glucan branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bvu  Bacteroides vulgatus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bvu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BVU_3322
Enzymes [BR:bvu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     BVU_3322
Exosome [BR:bvu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BVU_3322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4157434..4159461)
Genome map
AA seq 675 aa AA seqDB search
MENTTPKLGIIESDPWLEPYSAAIEGRHQHALDKELELTGGKGTLSDFATGYLYFGLHRT
RRGWVFREWAPNAKEIYLIGDFNDWKEHGDYRMYHVKNSPGVWEVELQSGAIKHGDLYKL
KVRWNGGEGERIPAWANRVVQDEQTKIFSAQVWEPENPYRFRKKVFRAKTDPLMIYECHI
GMAQEEERVGTYNEFREKILPRIAEAGYNCIQIMAIQEHPYYGSFGYHVSSFFAPSSRFG
TPDELKELIDTAHRMGIAVIMDIVHSHAVKNEVEGLGNFAGDPNQYFYPGGRREHPAWDS
LCFDYGKNEVIHFLLSNCKYWMDEFRFDGFRFDGVTSMLYYSHGLGEAFCNYGDYFNGNQ
DDNAICYLTLANKLIHQVNSKAITIAEEVSGMPGLAAPIQDGGYGFDYRMAMNIPDYWIK
TIKEKIDEDWKPSSMFWEVTNRRKDEKTISYAESHDQALVGDKTIIFRLIDADMYWHFQK
GDENYTVHRGIALHKMIRLLTASTINGGYLNFMGNEFGHPEWIDFPREGNGWSHKYARRQ
WGLFDNKNLCYHYLGDFDSAMVHLIESVKNIQETPVIEVWHNDGDQVLAYRRKNLIFVFN
FNPTKSFTDYGFLVPVGAYDVVLNTDATAFGGNGLADDSIRHFTNFDPLYKKDKKEWLKL
YLPARSAVVLKKVKE
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atggaaaataccactcctaaattaggcataatagaaagtgatccttggctggaaccgtat
tcggcagcgattgaaggacgccatcagcatgcactagacaaagaattggaactgaccgga
ggcaaaggaactttatcggactttgccaccggatatttatatttcggcttgcatcgtacc
agaagagggtgggtgttccgtgaatgggctccgaatgcgaaggaaatttatcttatcgga
gatttcaacgactggaaagaacatggcgattataggatgtaccatgtaaagaactctcct
ggtgtatgggaggtggaattacaaagcggtgctataaagcatggtgatttgtataaactg
aaagtccgttggaatggcggtgaaggagaacgcataccggcatgggccaaccgtgtggta
caggatgagcagacaaagatattcagtgcacaggtctgggaaccggagaatccttaccgg
ttcagaaagaaggtgttccgtgcaaagactgatcctttgatgatttatgaatgtcatatc
ggtatggctcaggaagaagaaagggtagggacttataatgagttccgtgagaaaatattg
ccgcgtatagcggaagccggatataactgtattcagattatggctattcaggagcatcct
tattatgggagtttcgggtatcatgtttccagtttctttgctccgtcatcccgcttcggt
acaccggatgaattgaaggaattgattgatacggcacatagaatgggaattgccgtcatt
atggatattgttcactctcatgccgtgaagaatgaagtggagggacttggcaattttgcc
ggtgatcctaatcaatacttctatccgggcgggcggcgtgaacatccggcatgggattcc
ttatgctttgattatggtaagaatgaggtgattcatttcttgctgtccaattgtaagtat
tggatggatgagttccgttttgacggttttcgttttgacggtgtgacatcgatgttgtat
tatagccacggcttgggagaggcgttctgtaattatggggattactttaacgggaatcag
gatgataatgcgatttgttatttgacattggccaacaagttgattcatcaggtaaattcc
aaagcgattaccattgcggaagaagtttcgggtatgcccgggttggcagcaccgattcaa
gatggtggatatgggtttgattaccgtatggccatgaatattccggattattggattaaa
acaatcaaggagaagattgatgaagactggaaaccgagcagcatgttctgggaagtgacc
aacagacgcaaggacgagaagactatttcgtatgccgaaagccatgaccaggcattggtg
ggcgataagactataattttccgtctgatagatgctgacatgtattggcatttccagaaa
ggggatgaaaattatacagtgcatcgcggcatcgcattgcataagatgattcgtttgctt
actgcctctaccatcaatggaggatatttgaactttatgggtaatgaattcgggcatccc
gaatggattgatttcccgcgtgaaggtaacggatggtcgcataaatatgcccgtcgtcag
tgggggctttttgataataagaacctgtgttaccattacttgggcgattttgattcagct
atggtccacctcattgagagtgtgaaaaatattcaggaaactccagtgattgaagtatgg
cataacgacggtgaccaagtgttggcttaccggcgtaagaatttgatttttgtatttaat
ttcaatcctaccaagtcatttacagactatggtttcctagtgcctgtcggggcgtatgat
gtggtactgaatacggatgcgacagctttcggaggcaatggtctggctgatgacagtata
cgtcatttcactaatttcgaccctctttataagaaggataaaaaggaatggctgaaactg
tatctgcctgcccgttcggctgtggtattgaaaaaagtgaaagagtaa

DBGET integrated database retrieval system