KEGG   Bacteroides vulgatus: BVU_3329Help
Entry
BVU_3329          CDS       T00546                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
bvu  Bacteroides vulgatus
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bvu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BVU_3329
Enzymes [BR:bvu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     BVU_3329
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4164817..4165191
Genome map
AA seq 124 aa AA seqDB search
MDEHHCLLCMGSNTNRYAQLSVAREALRTTFPDIHFGEMMETEAVGSGFHSPFSNQLAKF
STTLSPDSVRDLFKELERRSGRIPEDKAQGVVKLDIDLLVFDNKILKPEDMEREYIRRGM
SVLF
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atggacgaacaccattgtttgctttgtatgggctctaataccaaccgttacgcgcaactc
tcggttgcacgggaagcattgcgcaccacgtttcccgacattcatttcggcgagatgatg
gaaacggaagctgttggcagcggctttcactcccctttcagcaatcaactggcaaaattc
agcactacgctttcacccgattccgttcgtgatttgtttaaagaattggaacgacgcagc
ggacggattcccgaagacaaggctcaaggggtggtaaaactggatattgacctgctggtc
tttgacaataagatattgaaaccggaagatatggaaagagaatatatccgccgtggaatg
tctgtgctcttttag

DBGET integrated database retrieval system