KEGG   Bacteroides vulgatus: BVU_3337Help
Entry
BVU_3337          CDS       T00546                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bvu  Bacteroides vulgatus
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bvu00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bvu00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4172491..4173432
Genome map
AA seq 313 aa AA seqDB search
MENRSLVTIAEHSKEKILYLLEMAKEFEKKPNRKILDGKVVATLFFEPSTRTRLSFETAA
NRLGARVIGFTDPKVTSSSKGETLKDTIMMVSNYADIIVMRHFLEGAARYASEVAPVPIV
NAGDGANQHPSQTMLDLYSIYKTQGTLENLNIYLVGDLKYGRTVHSLLMAMRHFNPTFHF
IAPEELKMPEEYKIYCKEHHIKYKEYTDFNEETIADADILYMTRVQRERFTDLMEYERVK
DVYILRNKMLEHTRPNLRILHPLPRVNEIAYDVDENPKAYYFQQAQNGLYARQAILCDVL
GITLNDVIEDAKK
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatagaagtttagttactattgccgaacactcgaaagagaaaatcctctacctt
ttggagatggcaaaagagtttgaaaagaagcctaaccgtaaaatcttggacggcaaagtt
gttgccacccttttctttgagccctccacccgtacacgactcagttttgaaaccgcagca
aacagactgggagcccgcgttatcggatttaccgatcccaaagtaaccagttcttcaaaa
ggagaaacattgaaagataccatcatgatggtaagcaattacgccgacatcatcgtaatg
cgccattttctggaaggtgccgcaagatatgccagcgaagtcgccccggtgcccattgtc
aatgccggagacggagccaaccaacatccgtcacaaaccatgctagacctctactccata
tacaaaacacagggaacgcttgaaaatttaaacatctatctagtaggcgacttgaaatac
ggacgaactgttcattctttgctgatggctatgcgtcatttcaaccccactttccatttc
atcgctccggaagagttgaaaatgcctgaagaatataaaatctactgcaaggagcaccat
attaaatacaaagagtacacagactttaacgaagaaaccattgctgacgccgacattctt
tacatgacccgtgtacaacgcgaacgtttcaccgacctgatggaatatgaacgtgtgaaa
gatgtatatatattaaggaataagatgctggagcatacccgccccaatctgcgtatcctg
caccctctgccccgcgtcaacgaaatagcttacgatgtggatgagaatccgaaagcttac
tatttccagcaggcacaaaacggactttatgcgcgccaggccatcctttgtgatgtattg
ggcataaccttgaatgatgttatagaagatgcaaaaaagtaa

DBGET integrated database retrieval system