KEGG   Bacteroides vulgatus: BVU_3409Help
Entry
BVU_3409          CDS       T00546                                 

Definition
(GenBank) ATP-dependent exonuclease V, alpha subunit - helicase superfamily I member
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bvu  Bacteroides vulgatus
Pathway
bvu03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bvu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BVU_3409
Enzymes [BR:bvu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BVU_3409
DNA repair and recombination proteins [BR:bvu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     BVU_3409
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 HHH_4 AAA_19 UvrD_C_2 HHH_5 AAA_11 Viral_helicase1 Helicase_RecD PIF1 HHH_2 HHH T2SSE AAA_28 ArgK UvrD_C TsaE TrwB_AAD_bind NTPase_1 Ribosomal_S13 PhoH HHH_3 CbiA DEAD AAA Fer4_NifH ATPase AAA_33 RsgA_GTPase SRP54 NACHT UvrD-helicase
Motif
Other DBs
NCBI-ProteinID: ABR41035
UniProt: A6L5S1
Position
complement(4249215..4251476)
Genome map
AA seq 753 aa AA seqDB search
MLKLRCVVERITYQNPENGYSVMRVKVKSYDDLVTLVGNLLEVPAGSVLLCEGEWKVDKR
YGSQFVCQSWEEVMPATVYGIEKYLGSGLVKGIGPKFAQLIVRQFGLETIDVIETDIERL
YEVPGIGKKRVEKICESWEKQKDIKNVMLFLQGYGVSTAYAAKIYRQYGKESIDKVKENP
YRLADDIWGIGFKTADSIAAKMGYEKNDLRRCKSGIIYTLNQLANEGHVYAEEEQLVQAA
LELLEADEAPIREALNNMVQTDDLKLEDEAIYLPPFYFAEVGTTNRLQALLRESEQNLFA
KKVDVQALSKETGIEYDEVQLQAIEEAIRSKVMVLTGGPGTGKTTTTQGIIAALKHMGLR
ILLAAPTGRAAKRMSEATGMESKTIHRLLEFNPKDGYKRNDENPLEGDALIVDECSMIDI
ILMNNLMKAIPSSMRVVFVGDIDQLPSVGAGNVLRDIIESEKIPVIRLTRIFRQAQTSRI
VMSAHAINQGRFPDTSNGKQTDFFFIQQEEPEKVAEEIVNLVKNRLPKAYSQGVSNIQVL
TPMQRGVVGAANLNMALQNALNPSQIALNRGGYSFRQGDRVMQLRNNYDKDVFNGDLGYV
ESVDMEERTLLVNFEERQVEYEASELDELTLAYATTIHKSQGSEYPIVVMPVLMTHYVML
QRNLVYTGITRAKKICVLIGTKKALSFAIRNMSVLKRNTKLKERLNPELAKPTEKKPVEK
KLSKIYPMNEPVLEAAAEPSESYGKKQPTIETK
NT seq 2262 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaacttcgctgcgtagtagaaagaatcacctaccaaaatcccgagaacgggtat
tcggtgatgagggtcaaggtcaaaagctatgacgacctggtgacactggtgggcaacctg
ctggaggtgcctgccggaagtgtgctgttatgtgagggcgaatggaaggtggacaaacgc
tacggcagccagttcgtgtgccaatcgtgggaggaggtgatgccggccacggtctatggc
attgagaagtatctgggaagcggactggtaaaaggcatcggtccgaagtttgcccaactc
atcgtccgtcagtttggtctggaaaccatcgatgtgatcgagaccgacatcgaacggctc
tacgaggtgccgggcatcggcaagaagcgcgtggagaagatttgcgagagttgggagaag
cagaaggacatcaagaatgtgatgcttttcctgcaggggtatggtgtcagtacggcctat
gcggccaagatttaccgccagtacggcaaggaaagcatcgacaaggtaaaggagaaccct
taccgactggctgacgacatctggggcatcggcttcaagacggccgacagcattgcagcg
aagatgggctacgaaaaaaatgacctccgccgctgtaagagtggcatcatctacaccttg
aatcagttggccaacgaagggcatgtctatgctgaagaggaacagttggtacaagctgcg
ttggaattgctggaagcggacgaagcgcctatccgtgaggctttgaataatatggtgcag
acggatgacttgaagttggaagacgaagccatctatctgccgcctttctactttgccgaa
gtaggtacgacgaacaggctgcaggctttgctccgtgaatcggaacagaacctctttgcc
aagaaggtagatgtgcaggctttatcaaaggaaactggcattgaatatgacgaggtgcag
ctgcaggccatcgaggaagccatccgttcaaaagtaatggtactgacggggggaccgggt
acgggtaagactaccaccacgcagggtatcattgcggctttgaagcatatgggacttcgc
attctgctggcggctcctacgggacgggcagccaaacgtatgagtgaagccaccgggatg
gagtccaagaccattcaccggctgctggagttcaatccgaaagacggctacaagcggaat
gatgagaatcccttggaaggggacgcactgattgtggacgagtgttcgatgattgacatc
atcctgatgaacaacctgatgaaggccattccctcttccatgcgcgtggtcttcgtgggc
gacattgaccagttgccgagtgttggtgccggcaatgtgttgcgcgacatcattgagagt
gaaaagattccggtgattcgactgacccgtattttccgtcaggcgcagaccagccgcatt
gtgatgagtgcccatgccatcaaccagggacgtttccccgatacgagcaacggcaagcag
acggatttctttttcatccaacaggaggagccggagaaggtggcggaggaaattgtgaat
ctggtgaagaaccgcctgccgaaagcctacagccaaggggtgagcaacattcaggttttg
acccccatgcaacgcggtgtggtgggtgctgccaatctgaacatggccttgcaaaatgca
ctgaatccttcccagattgccttgaacaggggaggttattccttccgtcagggcgaccgg
gtgatgcagctgcgcaacaactacgacaaggatgtgttcaacggggacctcggctatgtg
gaatcggtagatatggaggaacgtacgctgctggtgaactttgaggagcgtcaggtggaa
tacgaagcctcagaactggatgagttgacactggcctacgctacgaccattcacaagtcg
caaggatcggaatatcccatcgtggtgatgccagttcttatgacacactatgtaatgctg
cagcgtaacctggtttatacgggcatcacccgtgccaagaagatttgcgtgctcatcggt
accaaaaaggcgctttcatttgccatccgcaacatgtcggtgttgaaacggaacacgaaa
ctgaaggagcgactgaatccggaattggcaaaacccacggagaagaagcctgtagagaag
aagttgagcaaaatttatccgatgaacgaacctgttttggaagctgccgccgaacccagc
gaaagttacggaaagaaacaacctaccattgaaacgaaatag

DBGET integrated database retrieval system