KEGG   Bacteroides vulgatus: BVU_3466Help
Entry
BVU_3466          CDS       T00546                                 

Definition
(GenBank) putative terpenoid biosynthesis-related protein
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bvu  Bacteroides vulgatus
Pathway
bvu00900  Terpenoid backbone biosynthesis
bvu01100  Metabolic pathways
bvu01110  Biosynthesis of secondary metabolites
bvu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bvu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BVU_3466
Enzymes [BR:bvu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     BVU_3466
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N Tup_N TMP-TENI AGT
Motif
Other DBs
NCBI-ProteinID: ABR41090
UniProt: A6L5X6
Position
complement(4317092..4317919)
Genome map
AA seq 275 aa AA seqDB search
MITFPNAKINLGLNIVEKRPDGYHNLETIFYPINLQDALEVTRRENNDKEYTLHISGSPL
EGEPEDNLVVQAYKLLKKDYPGLLPVDIHMYKHIPAGAGLGGGSSDAACMIKLLNDKFSL
GLSTERMEEYAVKLGADCAFFIRNKPVFATGIGNLFEPVELSLKGYHIILIKPDIFVSTR
DAFAEIKPVRPAVSLKEIVKQPMETWKNSMKNDFEDSVFKKFPEIAAIKDELYDLGAVYA
AMSGSGSSVYGIFKAPIENVEDKFCGCFCRQRALE
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgattacatttcctaatgcaaagattaatttgggacttaatattgtagaaaagcgcccg
gatggataccacaatctggaaaccatattttatccgataaacctgcaagacgctctggaa
gtgacgcggcgggaaaacaatgacaaagaatacactttacacataagcggatctcctttg
gagggtgaacccgaagataatctggtagtacaagcctacaagttattaaaaaaagactat
cccggactgttgccggtagatatacacatgtacaagcatataccggcgggtgccggactg
ggtggcggatcatcagatgccgcttgtatgataaagcttctgaatgataaattttcattg
ggactcagtacggaacggatggaggaatatgcggtaaaactaggggcagactgtgctttt
ttcattcggaacaaacctgttttcgctaccggaatagggaatctgttcgagcctgtggaa
ttgtcattaaagggataccacataattttgattaaacctgatatctttgtgtccacccgg
gatgcgtttgccgaaataaagcctgtgcgtccggctgtttctttgaaagaaattgtaaag
caacctatggaaacatggaaaaacagtatgaagaatgattttgaagatagtgtcttcaaa
aagttccctgagattgctgctataaaagatgaattgtatgatttgggggcagtgtatgcc
gccatgagtggctcggggtcttccgtctatggtattttcaaagcaccgatagagaatgtg
gaagataaattctgtggatgcttttgcagacagagagcgttggaatag

DBGET integrated database retrieval system