KEGG   Bacteroides vulgatus: BVU_3751Help
Entry
BVU_3751          CDS       T00546                                 

Definition
(GenBank) putative cellulase M and related protein
Organism
bvu  Bacteroides vulgatus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4634689..4635735)
Genome map
AA seq 348 aa AA seqDB search
MEFNTSFLKHVSSIIAPSGYEKEVIDVWCKEMSQYVDEINLTNIGNAIAVKHGCGDTRKK
IMITAHADEIGIIVTYIDNNGYLYFDEIGGIDTNILPGRTVLIKGVDNRIIKGVIGVKPI
HLQKDSGSKQSLNPEDLWIDICVSNKESALELVEVGSIGTLESVAYQQGTKVIGKAMDNR
CSLSAMVSIAKILAEKKCNDDIFYVATTQEELRGRGAQTAAFAINPDICIVLDVTHATDY
PGMSPIRDGDINLGKGVVVAIGPNMDNEITKKVVSLAKNLNISYQVEVCARPTGTDANVV
QISRDGIRTLLLSIPCRYMHSPVETIDIEDLKSCCTLITKLIENRHYL
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggagtttaatacaagttttctaaagcatgtatcaagtataattgcaccatccggttat
gaaaaagaagttattgatgtatggtgcaaagaaatgtcacaatatgttgatgagattaat
cttacaaatataggtaatgctatagcagtaaaacatggctgtggagatacacgaaaaaaa
ataatgataactgctcatgccgatgaaattggaataatagtaacttatattgataataat
ggttatttgtattttgatgaaataggtggaatagatactaatattcttccgggtagaaca
gtgttgataaaaggtgttgataatcgtattattaaaggagttataggagttaaaccaatt
catctccaaaaggattctggttctaagcaatcattaaatcctgaagatttgtggattgat
atttgcgtaagtaataaagaatcagctttagagttagtagaagttggtagtataggaaca
ttggaatcagtagcatatcaacaaggtacaaaggtgataggaaaggctatggacaataga
tgctccctttcagcaatggtttctatagctaaaatacttgcagaaaaaaaatgtaatgat
gacatattttatgttgccacaactcaggaagaacttagaggaagaggagcgcagactgct
gcatttgctataaatccggatatatgtatagttttggatgtaactcatgcaacagattac
cctggaatgtctccaataagagatggtgatataaatttgggaaaaggtgttgttgttgca
attggtcccaatatggataatgaaattacgaaaaaagttgtatctttggcaaagaatttg
aatatcagctatcaggtagaggtttgtgcacgtcctaccggtactgatgctaatgtggtt
cagattagccgtgatggaatacgtacattgttattgagtattccttgtagatatatgcat
agtcctgtagagaccatagatatagaagatttaaaaagttgctgtactttaataactaag
ttaatagagaacagacattatttataa

DBGET integrated database retrieval system