KEGG   Bacteroides vulgatus: BVU_3851Help
Entry
BVU_3851          CDS       T00546                                 

Gene name
hisH
Definition
imidazole glycerol phosphate synthase subunit HisH
Orthology
K02501  
glutamine amidotransferase [EC:2.4.2.-]
Organism
bvu  Bacteroides vulgatus
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bvu01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:bvu00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4752334..4752924
Genome map
AA seq 196 aa AA seqDB search
MKIAVVKYNAGNIYSVDYALKRLGVEATITSDKEVLMSADKVIFPGVGEAETTMSHLRKN
RLDEVIKNLKQPVLGICLGMQLMCRHSEEGNADCLGIFDTDVKLFSPTRHEDKVPHMGWN
TLTHVRSDLFKGFTKEEFVYFVHSFYVPLNEFTAAQTDYILPYSSALHKDNFYATQFHPE
KSGAVGERILRNFLEL
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgctgtcgtaaaatataatgcaggaaacatctactccgtagactatgcactg
aagcgccttggagtagaagcaaccatcacttccgataaggaagtattgatgagtgccgac
aaagttatcttccccggtgtgggcgaagccgaaacaaccatgagccatctccggaaaaac
cggttggatgaagttattaaaaacttaaaacaacctgtactaggtatctgcctgggaatg
cagctgatgtgccggcactccgaagaaggaaatgctgactgcttgggcatctttgatact
gatgtaaagttgttcagccccacccggcatgaagacaaagtaccccatatgggatggaac
accctgactcatgtacgcagcgacctgttcaaaggattcaccaaagaagaatttgtatac
ttcgtacatagcttctatgtgcctctgaacgagtttacggcagcacaaacagattatatc
ctcccctacagttcggccttgcacaaagataatttctatgcgacacagttccatcccgaa
aagagcggagccgtgggcgaacgaatcctgaggaactttttagaattgtga

DBGET integrated database retrieval system