KEGG   Bacteroides vulgatus: BVU_4009Help
Entry
BVU_4009          CDS       T00546                                 

Gene name
asnB
Definition
asparagine synthetase B
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bvu  Bacteroides vulgatus
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bvu00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4940926..4942596
Genome map
AA seq 556 aa AA seqDB search
MCGIVGIFKIKQQTQELRQKALKMSQKLRHRGPDWSGIYVGDSAILAHERLSIVDPQSGG
QPLYSPDRKQILAVNGEIYNHRDVRAKYAEKYDFHTGSDCEVILALYRDKGIHFLEELNG
IFAFALYDEEKDDFLIARDPIGVIPLYIGKDKDGKIYCASELKALEGFCDEYEPFLPGHY
YWGKEGKMTRWYVRDWFEYEAVKNNNAYSLDIHDGLEEAVKRQLMSDVPYGVLLSGGLDS
SVISAIAKKYAGKRVETDNKKDAWWPQLHSFAIGLEGAPDLIKAREVARFIGTVHHEIHY
TIQEGLDAIRDVIYYIETYDVTTVRASTPMYLLARVIKSMGIKMVLSGEGADEVFGGYLY
FHKAPTAQAFHEETVRKLGKLHLYDCLRANKSLAAWGVEGRVPFLDKDFLDIAMRLNPEA
KMCPGSTIEKKIVRKAFADMLPDSVAWRQKEQFSDGVGYSWIDTLKALTAEAVSDEQMAH
AAERFPINTPQNKEEYYYRSIFQEHFPSESAARSVPSVPSVACSTAEALAWDAAFKNMNE
PSGRAVKGVHEEAYDS
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaatcgtaggaatattcaagataaagcaacaaacgcaggaactgcgtcagaag
gcattgaaaatgtcacaaaagctccgccaccgcgggccggactggagcggcatctacgta
ggcgactctgccatcctggcccatgaacgcctctccatcgtagaccctcaaagcggaggg
caacccctatatagtcccgaccggaaacaaatcctcgccgtgaacggagaaatctacaac
catcgggatgttcgtgcaaagtacgccgaaaaatatgatttccataccggaagcgattgc
gaagtcatccttgccctttaccgtgacaaaggtattcacttcctcgaagagctgaacggc
atcttcgccttcgccctttatgatgaggagaaagacgatttcctcattgcccgcgacccc
atcggagtcatacctttatatataggtaaggataaggacggcaaaatatactgcgccagc
gagttgaaagccctcgaagggttctgtgatgaatacgaacccttccttcccggccattac
tattggggaaaagaaggcaagatgacccgctggtacgtccgcgactggtttgaatacgaa
gccgtgaaaaacaacaatgcctattccctggacatacacgacggactggaagaggccgtt
aaacgccaactgatgagtgatgtgccctacggcgtacttctttccggcggtctggacagt
tccgtcatctctgccattgccaagaaatatgcaggcaaacgggtagaaaccgacaataaa
aaagatgcctggtggcctcagctccattcctttgccatcggtctggaaggtgcgcccgac
ctgataaaagcccgcgaagtggcccgctttatcggaaccgtgcatcatgaaatccactat
accatccaagaaggattggacgctatccgcgacgtcatttactacatcgagacttacgat
gtcaccaccgttcgcgcctctaccccgatgtatttgctggcacgcgtcattaaaagcatg
ggaatcaaaatggtgctgagtggcgaaggggctgatgaagtgttcggcggctatctctat
ttccacaaagcccctacagcccaagcctttcatgaagaaaccgtgcgtaaactaggcaaa
ctccacctctatgactgcctccgtgccaataaatccctcgcagcatggggagtggaaggc
cgagtgcctttcctggacaaagattttctggacatagccatgcgcctcaatcccgaggca
aagatgtgccccggaagcaccatcgaaaagaaaatagtccgcaaagcctttgcagacatg
ttgcccgacagtgtagcatggcgacagaaagagcagttcagcgacggcgtgggctatagt
tggattgatacactgaaagcccttaccgccgaagccgtcagtgacgagcaaatggcgcac
gcagccgaacggtttcctatcaatacgccgcaaaacaaggaagaatactactatcgcagc
atcttccaggagcactttcccagtgaaagcgcagcccgcagcgtgccaagcgtgcccagt
gtggcatgttctacagccgaagcccttgcgtgggacgccgccttcaagaacatgaacgaa
ccaagcggacgggccgtgaagggagtgcacgaagaagcatatgattcataa

DBGET integrated database retrieval system