KEGG   Bacteroides vulgatus: BVU_4087Help
Entry
BVU_4087          CDS       T00546                                 

Definition
(GenBank) tryptophan synthase beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bvu  Bacteroides vulgatus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bvu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BVU_4087
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BVU_4087
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BVU_4087
Enzymes [BR:bvu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BVU_4087
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
5029520..5030719
Genome map
AA seq 399 aa AA seqDB search
MKTYQVNKEGYYGEFGGAYIPEILHRCVEELQNAYSKVLESEGFKQEFHQLLRDYVGRPS
PLYLANRLSKKYGCKIYLKREDLNHTGAHKINNAIGQVLLAKRMGKKRIIAETGAGQHGV
ATATVCALMNMQCIVYMGKTDVERQHINVEKMKMLGAEVRPVTSGNMTLKDATNEAIRDW
CCHPADTYYVIGSTVGPHPYPDMVARLQSVISEEIKKQLKEQEGREYPDYLMACVGGGSN
AAGTIYHYIDDERVQIVLAEAGGKGIDTGFSAATIQLGKMGIIHGAKTLVIQNEDGQIEE
PYSISAGLDYPGIGPMHANLAKQQRALVLAINDDEAIRAAFELTRLEGIIPALESAHALG
ALDKMRFKPTDIVVLTVSGRGDKDIETYLKESGTRTSLQ
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacttatcaggtaaacaaagaaggttattatggcgaatttggaggggcgtatatt
cccgaaatccttcaccgctgtgtggaagaattgcagaatgcctattccaaagtattggaa
agtgaaggattcaaacaagaattccaccagttactacgcgactatgtaggacgcccttca
cctctttacctggcaaaccggctaagcaagaaatatggctgtaagatctacctgaaacgt
gaagatttaaaccacaccggagcacataaaatcaataatgccatcggacaggtgttactg
gcaaaacgtatggggaaaaaacgtatcattgcagaaaccggagctggacagcatggggtg
gccaccgctacggtatgcgctttgatgaacatgcaatgcattgtttacatgggcaagacc
gatgtagaacgccagcatatcaatgtagaaaagatgaaaatgctgggagccgaagtccgc
ccggtcacttccggcaacatgacactgaaagatgctacaaacgaagccatccgcgactgg
tgttgccaccctgccgatacttactatgtcatcggctctaccgtaggccctcatccctac
cctgatatggtggcacgtctgcaatccgttatcagcgaagaaatcaaaaagcagctgaaa
gaacaggaaggaagggaatatcccgattacttgatggcttgtgtaggaggaggaagcaat
gcggcaggaaccatttatcactatatagatgatgaacgtgtgcagattgtcctggccgag
gcaggaggcaaaggtatagacaccggtttctcggccgctaccatccaactggggaaaatg
ggaattatccacggagcaaagaccttggttatccaaaacgaggacggacaaatagaggaa
ccttactccatttctgccggtctggattatccgggcataggacccatgcatgccaatctg
gccaaacagcaacgcgctttggtactcgccataaacgatgatgaagccatccgtgccgca
tttgagctgacccggctggaaggtatcattcctgcattggaatcggctcatgcattggga
gcattggacaaaatgagattcaagccaacggatatagtggttctcaccgtatcaggacgc
ggagataaggatattgaaacctacttgaaagaatccggcacaaggacctccttgcaataa

DBGET integrated database retrieval system