KEGG   Bacteroides vulgatus: BVU_4093Help
Entry
BVU_4093          CDS       T00546                                 

Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bvu  Bacteroides vulgatus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bvu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BVU_4093
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BVU_4093
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BVU_4093
Enzymes [BR:bvu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BVU_4093
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
5035254..5036030
Genome map
AA seq 258 aa AA seqDB search
MNRINQLFSTKQKDILSIYFCAGFPTLEGTASTIKVLEKKGINMIEIGIPFSDPMADGPV
IQHAATRALKNGMTLKLLFDQLKDIRKEVQIPLVLMGYLNPIMQYGFKDFCRTCRETGID
GVIIPDLPFKDYMEEYRSIAEEQDVRIIMLITPETSEERIRLIDEHTDGFIYMVSSAAIT
GAQKDFNAQKQAYFQRIADMNLRNPRMIGFGISNKQTFETASAHAAGAIIGSKFVTLLDE
EDGDTEKAADKLLEALKN
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaacagaatcaaccagttattcagtaccaagcaaaaagacatcctatctatttatttt
tgtgcaggctttcctaccttagaaggtacggcaagcaccatcaaagtcctggaaaaaaaa
gggattaacatgattgaaatcggcattcctttcagtgacccgatggctgacggtcccgtt
atccagcacgccgccacccgcgccttgaaaaatggcatgacactgaagctccttttcgac
caactgaaagatatccgtaaagaagtacagattccgctggtgctgatgggatatctcaat
cccatcatgcaatatggattcaaggatttctgccgcacttgccgggagacgggaatcgac
ggagtgattatccccgacttgcctttcaaagattatatggaggaatatcgttccatagcc
gaggaacaagatgtgagaatcatcatgctcatcactccggaaaccagtgaagaacgtatc
cgcctgattgatgaacataccgacggttttatctatatggtatcttccgccgctatcacc
ggtgctcaaaaagatttcaacgcacagaaacaagcctatttccaacgcatcgccgacatg
aatttacgcaatccccgcatgataggtttcggaatttccaataagcaaaccttcgaaacc
gcatccgctcatgccgcaggagccatcatcggcagtaaattcgtgaccttgctggatgaa
gaagacggagatacggaaaaagcagcggacaagctgctggaagccttgaaaaactaa

DBGET integrated database retrieval system